Recombinant Human Corticosteroid-binding globulin(SERPINA6)

In Stock
Code CSB-EP021062HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SERPINA6
Uniprot No. P08185
Research Area Transport
Alternative Names CBG; CBG_HUMAN; corticosteroid binding globulin; Corticosteroid-binding globulin; serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6; Serpin A6; serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6; Serpina6; Transcortin
Species Homo sapiens (Human)
Source E.coli
Expression Region 23-405aa
Target Protein Sequence MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 69.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

Regarding CSB-EP021062HU -Corticosteroid Binding Globulin , Does the method you use in protein purification involves the use of cortisol (or other related compound that may be bound to the recombinant CBG)?
We are planning to do experiments on cortisol binding, I would like to confirm that the recombinant CBG you have contains or does not contain bound cortisol.

A:
Very nice to receive your inquiry. This is a ready-to-ship protein. The product details are as below.
Lead Time: 3-5 working days
Expression Region: 23-405aa, full length
Tag Info: N-terminal GST-tag
Target Protein Sequence:

MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV


We use nickel column affinity purification method to purify this protein. There contains NO Cortisol in the storage buffer.
Q:

The GST tag is not listed in this sequence below, so I want to know if the N terminal GST tag is intact in the final protein that is delivered to us or is it cleaved or removed during the final purification step. The expression Region: 23-405 with N terminal GST tag; AA Sequence:

MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV

A:
Very nice to receive your inquiry. CSB-EP021062HU is tagged with N-terminal GST-tag. The AA sequence refers to the target protein sequence. The complete sequence is as below.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT+MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV


Note: The sequence in front of "+" is the GST-tag sequence, and the sequence behind of "+" is the target protein sequence.

Target Data

Function Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
Gene References into Functions
  1. Data suggest that some individuals with adrenal insufficiency due to SERPINA6 mutations present with hypotension or nonspecific symptoms such as fatigue, nausea, or chronic pain, but symptomatology varies widely, even between family members with identical mutations. [REVIEW] PMID: 29194043
  2. In conclusion, site-specific CBG N-glycosylation regulates the bioavailability of cortisol in inflamed environments by fine-tuning the RCL proteolysis by endogenous and exogenous elastases. PMID: 27339896
  3. The results suggest reduced CBG cleavage in central obesity, possibly contributing to the characteristic inflammatory phenotype of the central obesity and metabolic syndrome. PMID: 27300474
  4. Corticosteroid-binding globulin cleavage may be pathogen-dependent in bloodstream infection PMID: 27887960
  5. Data indicate there was no significant circadian variation in serum cortisol-binding globulin (CBG) concentration in any of the 4 groups. PMID: 26603673
  6. Human cardiomyocytes express mineralocorticoid receptors, but are mostly free of nuclear glucocorticoid receptors. CBG is expressed in myocardium and in Purkinje fibers. CBG in heart is colocalized with mineralocorticoid receptor. PMID: 25251318
  7. SERPINA6-rs1998056 regulated by FOXA/ERalpha might be associated with female HCC risk PMID: 25198130
  8. genetic variation in the SERPINA6 gene may be associated with altered CBG levels during adolescence. PMID: 24691024
  9. the results suggest that DEX repression of Corticosteroid-binding globulin involves tethering of the glucocorticoid receptor to C/EBPb. PMID: 25335188
  10. 8 naturally occurring CBG mutants with abnormalities in cortisol-binding affinity, cortisol-binding capacity, production/secretion, sensitivity to proteolytic cleavage of the reactive center loop, or recognition by monoclonal antibodies used for ELISAs were identified PMID: 25322275
  11. The study investigate the half-life of intact and elastase cleaved CBG in the rabbit. The half-lives of intact and cleaved human CBG are 10 h and identical. PMID: 25636722
  12. CBG is coexpressed with hypothalamic neuropeptides.CBG may be involved in control of systemic and central stress response. PMID: 24246737
  13. Exome chip and 1000 Genomes imputation analysis of this locus in the CROATIA-Korcula cohort identified missense mutations in SERPINA6 and SERPINA1 that did not account for the effects of common variants PMID: 25010111
  14. Atomic interactions observed between progesterone and CBG explain the lower affinity of progesterone in comparison to corticosteroids. PMID: 23300763
  15. investigation of physicochemical, electronic, and structural requirements for selective and effective binding of steroids (many are endogenous steroid metabolites) to CBG and SHBG active/ligand-binding sites PMID: 22242800
  16. The influence of glucocorticoid receptor and corticosteroid-binding globulin gene polymorphisms in obesity and/or cortisol action in prepubertal obese children. PMID: 22576823
  17. three polymorphisms, -26 C/G, -54 C/T, and -144 G/C located close to the putative hepatic nuclear factor (HNF) 1 binding elements, altered the transactivation effect of HNF1beta PMID: 22932886
  18. genetic association studies in Chinese populations: Data suggest that SERPINA6 with SNP (A51V) is poorly produced/secreted; plasma corticosteroid-binding globulin levels in heterozygous subjects for this variant are 50% lower than in normal subjects. PMID: 22337907
  19. N-glycans are involved in the CBG:receptor interaction and indicates that the modulation is performed by steric and/or electrostatic means through the terminal neuraminic acid residues. PMID: 21558494
  20. We found that polymorphisms in SLC6A4, TPH2, and SERPINA6 appear to be maternal factors increasing the risk of having a child with facial clefts. PMID: 22072571
  21. Data show thatin chronic hepatitis C patients, IL28B polymorphism was associated with serum levels of corticosteroid binding globulin, a major transporter of cortisol. PMID: 21750736
  22. CBG influences the endocrine and neurobehavioral response to stress, including the development of pain/fatigue syndromes PMID: 21795453
  23. Allosteric modulation of hormone release from thyroxine and corticosteroid-binding globulins. PMID: 21325280
  24. Plasma cortisol responses attenuated more rapidly in the able-bodied men, compared to spinal cord-injured subjects, due to significant rise in circulating corticosteroid-binding globulin. PMID: 20839151
  25. SHBG, CBG and total cortisol and free plasma cortisol were measured and to investigate whether or not these analytes correlated with the degree of insulin resistance and the presence of the metabolic syndrome. PMID: 20354921
  26. Effect of mutations of SERPINA6 on cortisol-binding, and thermal and protease sensitivity are reported. PMID: 20226861
  27. findings support the hypothesis that the corticosteroid binding globulin level is an interesting indicator for both insulin resistance and low grade inflammation PMID: 12364459
  28. CBG-negative preadipocytes proliferated more rapidly and showed greater peroxisome proliferator-activated receptor-gamma-mediated differentiation than normal preadipocytes. CBG was not expressed in normal human preadipocytes. PMID: 12554596
  29. human Fallopian tube cells actively express and secrete a CBG-like progesterone-binding protein, which might play a role in the in vivo modulation of human sperm acrosome reaction PMID: 14871264
  30. Homozygosity for the serine allele of the CBG gene may predispose to chronic fatigue syndrome, perhaps due to an effect on hypothalamic-pituitary-adrenal axis function related to altered CBG-cortisol transport function or immune-cortisol interactions. PMID: 15554358
  31. Circulating adiponectin, CBG concentration, and fasting cortisol were significantly interrelated in healthy subjects. A significant sexual dimorphism exists in this association. PMID: 15877287
  32. We concluded that CBG gene polymorphisms might modulate the influence of the HPA axis on the fat mass distribution in obese women. PMID: 16222046
  33. To the best of our knowledge, this case represents the first de novo mutation reported for corticosteroid-binding globulin deficiency, implicating a pathogenic role of variants of SERPINA6 in some cases of muscle fatigue. PMID: 17245537
  34. A mechanism for the effect of CBG mutations on fatigue is not readily apparent because free cortisol levels are normal. PMID: 17547679
  35. The crystal structures of cleaved human CBG (cCBG) at 1.8-A resolution and its complex with cortisol at 2.3-A resolution, is reported. PMID: 18513745
  36. several substitutions (E334A, V336R, G340S, and T342P) increased the steroid binding affinities of human CBG even before elastase cleavage PMID: 19011238
  37. Results describe the expression of corticosteroid-binding globulin (CBG) in the low-grade malignant human astrocytoma cell line 1321N1. PMID: 19172388

Show More

Hide All

Involvement in disease Corticosteroid-binding globulin deficiency (CBG deficiency)
Subcellular Location Secreted
Protein Families Serpin family
Tissue Specificity Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
Database Links

HGNC: 1540

OMIM: 122500

KEGG: hsa:866

STRING: 9606.ENSP00000342850

UniGene: Hs.532635

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1