| Code | CSB-EP021062HU | 
| Abbreviation | Recombinant Human SERPINA6 protein | 
| MSDS | |
| Size | $224 | 
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat | 
Amino acids 23-405 constitute the expression domain of recombinant Human SERPINA6. This SERPINA6 protein is expected to have a theoretical molecular weight of 69.6 kDa. This SERPINA6 recombinant protein is manufactured in e.coli. The SERPINA6 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant SERPINA6 protein in following stages of expression and purification.
Corticosteroid-binding globulin (SERPINA6) is a glycoprotein primarily synthesized in the liver and belongs to the serine protease inhibitor (serpin) superfamily. Its main function is to bind and transport corticosteroids, such as cortisol and corticosterone, in the bloodstream. By forming stable complexes with these hormones, SERPINA6 modulates their availability and influences their distribution to target tissues. This protein is essential in regulating the levels of circulating corticosteroids, impacting various physiological processes like immune response, metabolism, and stress adaptation. Research on SERPINA6 extends to understanding its role in endocrine homeostasis, stress-related disorders, and inflammatory conditions, shedding light on potential therapeutic applications related to corticosteroid balance in different medical contexts.There are currently no reviews for this product.
Regarding CSB-EP021062HU -Corticosteroid Binding Globulin , Does the method you use in protein purification involves the use of cortisol (or other related compound that may be bound to the recombinant CBG)?
We are planning to do experiments on cortisol binding, I would like to confirm that the recombinant CBG you have contains or does not contain bound cortisol.
MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
The GST tag is not listed in this sequence below, so I want to know if the N terminal GST tag is intact in the final protein that is delivered to us or is it cleaved or removed during the final purification step. The expression Region: 23-405 with N terminal GST tag; AA Sequence:
MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT+MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV