Recombinant Human Corticosteroid-binding globulin(SERPINA6)


In Stock
Code CSB-EP021062HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P08185
Lead Time 3-7 business days
Relevance Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Serpin A6Transcortin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
Research Area Transport
Source E.coli
Gene Names SERPINA6
Expression Region 23-405aa
Tag Info N-terminal GST-tagged
Mol. Weight 69.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
Involvement in disease Corticosteroid-binding globulin deficiency (CBG deficiency)
Subcellular Location Secreted
Protein Families Serpin family
Tissue Specificity Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
Database Links

HGNC: 1540

OMIM: 122500

KEGG: hsa:866

STRING: 9606.ENSP00000342850

UniGene: Hs.532635

Q&A and Customer Reviews

Q&A
Q:

Regarding CSB-EP021062HU -Corticosteroid Binding Globulin , Does the method you use in protein purification involves the use of cortisol (or other related compound that may be bound to the recombinant CBG)?
We are planning to do experiments on cortisol binding, I would like to confirm that the recombinant CBG you have contains or does not contain bound cortisol.

A:
Very nice to receive your inquiry. This is a ready-to-ship protein. The product details are as below.
Lead Time: 3-5 working days
Expression Region: 23-405aa, full length
Tag Info: N-terminal GST-tag
Target Protein Sequence:

MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV


We use nickel column affinity purification method to purify this protein. There contains NO Cortisol in the storage buffer.
Q:

The GST tag is not listed in this sequence below, so I want to know if the N terminal GST tag is intact in the final protein that is delivered to us or is it cleaved or removed during the final purification step. The expression Region: 23-405 with N terminal GST tag; AA Sequence:

MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV

A:
Very nice to receive your inquiry. CSB-EP021062HU is tagged with N-terminal GST-tag. The AA sequence refers to the target protein sequence. The complete sequence is as below.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT+MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV


Note: The sequence in front of "+" is the GST-tag sequence, and the sequence behind of "+" is the target protein sequence.
Customer Reviews

Related Products

SERPINA6 Antibodies

SERPINA6 Antibodies for Homo sapiens (Human)

SERPINA6 Antibodies for Human

SERPINA6 Proteins

SERPINA6 Proteins for Homo sapiens (Human)

SERPINA6 ELISA Kit

SERPINA6 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.