Recombinant Human Corticosteroid-binding globulin (SERPINA6)

In Stock
Code CSB-EP021062HU
Abbreviation Recombinant Human SERPINA6 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
SERPINA6
Uniprot No.
Research Area
Transport
Alternative Names
CBG; CBG_HUMAN; corticosteroid binding globulin; Corticosteroid-binding globulin; serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6; Serpin A6; serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6; Serpina6; Transcortin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-405aa
Target Protein Sequence
MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
69.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 23-405 constitute the expression domain of recombinant Human SERPINA6. This SERPINA6 protein is expected to have a theoretical molecular weight of 69.6 kDa. This SERPINA6 recombinant protein is manufactured in e.coli. The SERPINA6 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant SERPINA6 protein in following stages of expression and purification.

Corticosteroid-binding globulin (SERPINA6) is a glycoprotein primarily synthesized in the liver and belongs to the serine protease inhibitor (serpin) superfamily. Its main function is to bind and transport corticosteroids, such as cortisol and corticosterone, in the bloodstream. By forming stable complexes with these hormones, SERPINA6 modulates their availability and influences their distribution to target tissues. This protein is essential in regulating the levels of circulating corticosteroids, impacting various physiological processes like immune response, metabolism, and stress adaptation. Research on SERPINA6 extends to understanding its role in endocrine homeostasis, stress-related disorders, and inflammatory conditions, shedding light on potential therapeutic applications related to corticosteroid balance in different medical contexts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding CSB-EP021062HU -Corticosteroid Binding Globulin , Does the method you use in protein purification involves the use of cortisol (or other related compound that may be bound to the recombinant CBG)?
We are planning to do experiments on cortisol binding, I would like to confirm that the recombinant CBG you have contains or does not contain bound cortisol.

A:
Very nice to receive your inquiry. This is a ready-to-ship protein. The product details are as below.
Lead Time: 3-5 working days
Expression Region: 23-405aa, full length
Tag Info: N-terminal GST-tag
Target Protein Sequence:

MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV


We use nickel column affinity purification method to purify this protein. There contains NO Cortisol in the storage buffer.
Q:

The GST tag is not listed in this sequence below, so I want to know if the N terminal GST tag is intact in the final protein that is delivered to us or is it cleaved or removed during the final purification step. The expression Region: 23-405 with N terminal GST tag; AA Sequence:

MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV

A:
Very nice to receive your inquiry. CSB-EP021062HU is tagged with N-terminal GST-tag. The AA sequence refers to the target protein sequence. The complete sequence is as below.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT+MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV


Note: The sequence in front of "+" is the GST-tag sequence, and the sequence behind of "+" is the target protein sequence.

Target Background

Function
Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
Gene References into Functions
  1. Data suggest that some individuals with adrenal insufficiency due to SERPINA6 mutations present with hypotension or nonspecific symptoms such as fatigue, nausea, or chronic pain, but symptomatology varies widely, even between family members with identical mutations. [REVIEW] PMID: 29194043
  2. In conclusion, site-specific CBG N-glycosylation regulates the bioavailability of cortisol in inflamed environments by fine-tuning the RCL proteolysis by endogenous and exogenous elastases. PMID: 27339896
  3. The results suggest reduced CBG cleavage in central obesity, possibly contributing to the characteristic inflammatory phenotype of the central obesity and metabolic syndrome. PMID: 27300474
  4. Corticosteroid-binding globulin cleavage may be pathogen-dependent in bloodstream infection PMID: 27887960
  5. Data indicate there was no significant circadian variation in serum cortisol-binding globulin (CBG) concentration in any of the 4 groups. PMID: 26603673
  6. Human cardiomyocytes express mineralocorticoid receptors, but are mostly free of nuclear glucocorticoid receptors. CBG is expressed in myocardium and in Purkinje fibers. CBG in heart is colocalized with mineralocorticoid receptor. PMID: 25251318
  7. SERPINA6-rs1998056 regulated by FOXA/ERalpha might be associated with female HCC risk PMID: 25198130
  8. genetic variation in the SERPINA6 gene may be associated with altered CBG levels during adolescence. PMID: 24691024
  9. the results suggest that DEX repression of Corticosteroid-binding globulin involves tethering of the glucocorticoid receptor to C/EBPb. PMID: 25335188
  10. 8 naturally occurring CBG mutants with abnormalities in cortisol-binding affinity, cortisol-binding capacity, production/secretion, sensitivity to proteolytic cleavage of the reactive center loop, or recognition by monoclonal antibodies used for ELISAs were identified PMID: 25322275
  11. The study investigate the half-life of intact and elastase cleaved CBG in the rabbit. The half-lives of intact and cleaved human CBG are 10 h and identical. PMID: 25636722
  12. CBG is coexpressed with hypothalamic neuropeptides.CBG may be involved in control of systemic and central stress response. PMID: 24246737
  13. Exome chip and 1000 Genomes imputation analysis of this locus in the CROATIA-Korcula cohort identified missense mutations in SERPINA6 and SERPINA1 that did not account for the effects of common variants PMID: 25010111
  14. Atomic interactions observed between progesterone and CBG explain the lower affinity of progesterone in comparison to corticosteroids. PMID: 23300763
  15. investigation of physicochemical, electronic, and structural requirements for selective and effective binding of steroids (many are endogenous steroid metabolites) to CBG and SHBG active/ligand-binding sites PMID: 22242800
  16. The influence of glucocorticoid receptor and corticosteroid-binding globulin gene polymorphisms in obesity and/or cortisol action in prepubertal obese children. PMID: 22576823
  17. three polymorphisms, -26 C/G, -54 C/T, and -144 G/C located close to the putative hepatic nuclear factor (HNF) 1 binding elements, altered the transactivation effect of HNF1beta PMID: 22932886
  18. genetic association studies in Chinese populations: Data suggest that SERPINA6 with SNP (A51V) is poorly produced/secreted; plasma corticosteroid-binding globulin levels in heterozygous subjects for this variant are 50% lower than in normal subjects. PMID: 22337907
  19. N-glycans are involved in the CBG:receptor interaction and indicates that the modulation is performed by steric and/or electrostatic means through the terminal neuraminic acid residues. PMID: 21558494
  20. We found that polymorphisms in SLC6A4, TPH2, and SERPINA6 appear to be maternal factors increasing the risk of having a child with facial clefts. PMID: 22072571
  21. Data show thatin chronic hepatitis C patients, IL28B polymorphism was associated with serum levels of corticosteroid binding globulin, a major transporter of cortisol. PMID: 21750736
  22. CBG influences the endocrine and neurobehavioral response to stress, including the development of pain/fatigue syndromes PMID: 21795453
  23. Allosteric modulation of hormone release from thyroxine and corticosteroid-binding globulins. PMID: 21325280
  24. Plasma cortisol responses attenuated more rapidly in the able-bodied men, compared to spinal cord-injured subjects, due to significant rise in circulating corticosteroid-binding globulin. PMID: 20839151
  25. SHBG, CBG and total cortisol and free plasma cortisol were measured and to investigate whether or not these analytes correlated with the degree of insulin resistance and the presence of the metabolic syndrome. PMID: 20354921
  26. Effect of mutations of SERPINA6 on cortisol-binding, and thermal and protease sensitivity are reported. PMID: 20226861
  27. findings support the hypothesis that the corticosteroid binding globulin level is an interesting indicator for both insulin resistance and low grade inflammation PMID: 12364459
  28. CBG-negative preadipocytes proliferated more rapidly and showed greater peroxisome proliferator-activated receptor-gamma-mediated differentiation than normal preadipocytes. CBG was not expressed in normal human preadipocytes. PMID: 12554596
  29. human Fallopian tube cells actively express and secrete a CBG-like progesterone-binding protein, which might play a role in the in vivo modulation of human sperm acrosome reaction PMID: 14871264
  30. Homozygosity for the serine allele of the CBG gene may predispose to chronic fatigue syndrome, perhaps due to an effect on hypothalamic-pituitary-adrenal axis function related to altered CBG-cortisol transport function or immune-cortisol interactions. PMID: 15554358
  31. Circulating adiponectin, CBG concentration, and fasting cortisol were significantly interrelated in healthy subjects. A significant sexual dimorphism exists in this association. PMID: 15877287
  32. We concluded that CBG gene polymorphisms might modulate the influence of the HPA axis on the fat mass distribution in obese women. PMID: 16222046
  33. To the best of our knowledge, this case represents the first de novo mutation reported for corticosteroid-binding globulin deficiency, implicating a pathogenic role of variants of SERPINA6 in some cases of muscle fatigue. PMID: 17245537
  34. A mechanism for the effect of CBG mutations on fatigue is not readily apparent because free cortisol levels are normal. PMID: 17547679
  35. The crystal structures of cleaved human CBG (cCBG) at 1.8-A resolution and its complex with cortisol at 2.3-A resolution, is reported. PMID: 18513745
  36. several substitutions (E334A, V336R, G340S, and T342P) increased the steroid binding affinities of human CBG even before elastase cleavage PMID: 19011238
  37. Results describe the expression of corticosteroid-binding globulin (CBG) in the low-grade malignant human astrocytoma cell line 1321N1. PMID: 19172388

Show More

Hide All

Involvement in disease
Corticosteroid-binding globulin deficiency (CBG deficiency)
Subcellular Location
Secreted.
Protein Families
Serpin family
Tissue Specificity
Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
Database Links

HGNC: 1540

OMIM: 122500

KEGG: hsa:866

STRING: 9606.ENSP00000342850

UniGene: Hs.532635

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*