Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CKMT1A

Uniprot No.

P12532

Research Area

Signal Transduction

Alternative Names

Acidic-type mitochondrial creatine kinase; CKMT; CKMT1; CKMT1B; Creatine kinase mitochondrial 1 (ubiquitous); Creatine kinase mitochondrial 1B; Creatine kinase U type mitochondrial; Creatine kinase U-type; KCRU_HUMAN; Mia-CK; mitochondrial; U-MtCK; Ubiquitous mitochondrial creatine kinase; UMTCK

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

40-417aa

Target Protein Sequence

ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

47.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The preparation of this recombinant Human CKMT1A protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a CKMT1A fragment (40-417aa) that could be translated into the CKMT1A protein and then transferred it into E.coli cells to express the recombinant CKMT1A protein molecule. In order to get the target protein with high purity, N-terminal 6xHis tag was used in the production. The purity is 90% determined by SDS-PAGE.

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Studies suggested that mitochondrial creatine kinase 1 in non-small cell lung cancer progression and hypoxia adaptation. In addition, CKMT1 is a key regulator of the permeability transition pore through a complex that is distinct from the classical permeability transition pore. The knock-down of the mitochondrial creatine kinase-1 by RNA interference causes the dissipation of the mitochondrial membrane potential. Mitochondrial creatine kinase-1 has been found to serve as a universal and functionally necessary gatekeeper of the PT-pore, as its depletion induces mitochondrial depolarization and apoptotic cell death.

Target Background

Function

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Gene References into Functions

The highly conserved residue E227 acts as the catalytic base to accept the guanidinium proton transferred from creatine in UMTCK. PMID: 27909311
Mitochondrial creatine kinase CKMT1 is necessary for survival of EVI1-expressing cells in subjects with EVI1-positive AML. PMID: 28191887
LRRK2 can interact directly with uMtCK to block its entry into mitochondria and its subsequent processing. PMID: 21370995
CKMT1 is a key regulator of the permeability transition pore through a complex that is distinct from the classical permeability transition pore. PMID: 24522192
mitochondrial creatine kinase expression in hepatocellular carcinoma may be caused by hepatocarcinogenesis per se but not by loss of mitochondrial integrity, of which ASB9 could be a negative regulator PMID: 24174293
The results indicated that uMtCK expression is associated with a poor prognosis in breast cancer and might serve as a tumor marker. PMID: 22982673
Significantly greater creatine kinase carbonylation is associated with chronic obstructive pulmonary disease PMID: 16166745
Because creatine kinase temporally buffers ATP, these observations support the hypothesis that a deficit in myofibrillar energy delivery contributes to chronic heart failure pathophysiology in human left ventricular hypertrophy. PMID: 16952984

Hide All

Subcellular Location

Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.

Protein Families

ATP:guanido phosphotransferase family

Database Links

HGNC: 31736

OMIM: 123290

KEGG: hsa:1159

STRING: 9606.ENSP00000406577

UniGene: Hs.654988

Code	CSB-RP098174h
Abbreviation	Recombinant Human CKMT1A protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Creatine kinase U-type, mitochondrial (CKMT1A)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage