Recombinant Human Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1)

Code CSB-EP005062HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CDK2AP1
Uniprot No.
Research Area
Cell Cycle
Alternative Names
CDK2 A1; CDK2 associated protein 1; CDK2-associated protein 1; CDK2AP1; CDKA1; CDKA1_HUMAN; Cyclin dependent kinase 2 associated protein 1; Cyclin-dependent kinase 2-associated protein 1; Deleted in oral cancer 1; DOC 1; DOC 1 related protein; DOC 1R; DOC-1; DOC1; DOC1R; DORC1; p12DOC 1; Putative oral cancer suppressor; ST19
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-115aa
Target Protein Sequence
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.4kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
specific inhibitor of the cell-cycle kinase CDK2.
Gene References into Functions
  1. A compelling relationship exists between high CDK2AP1 mRNA expression and lower TNM classification of breast cancer, which is consistent with CDK2AP1 having a tumour-suppressive function. PMID: 30343278
  2. Knockdown of CDK2AP1 in hESCs results in increased p53 and enhances differentiation and favors it over a self-renewal fate. PMID: 29734353
  3. DOC1 re-expression in oral cancer cells causes a reversal of EMT. DOC1 promotes NURD binding to a subset of target loci. PMID: 28683324
  4. The simultaneous overexpression of p12CDK2-AP1 and CD82 significantly suppressed the in vivo tumor growth. PMID: 27349208
  5. knockdown of CDK2AP1 in primary human fibroblasts reduced proliferation and induced premature senescence, with the observed phenotype being p53 dependent PMID: 25785833
  6. In summary, p12CDK2AP1 expression in myxofibrosarcoma cells induces G0/G1 arrest and mitochondria dependent proapoptotic activity and down-regulation of p12CDK2AP1 by shRNAi results in up-regulation of the CDK2 transcript and protein. PMID: 24889487
  7. Study reports that knockdown of CDK2AP1 by RNAi in glioma cells could effectively inhibit cell proliferation by inducing cell cycle arrest and apoptosis PMID: 24620959
  8. CDK2AP1 plays an important role in modulating the growth and tumorigenesis of lung cancer cells. PMID: 23404055
  9. Low CDK2AP1 expression is common and associated with adverse prognosis in nasopharyngeal carcinoma. PMID: 22791769
  10. Human cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) is dimeric in its disulfide-reduced state, with natively disordered N-terminal region PMID: 22427660
  11. exerts its effect on stem cell maintenance/differentiation through epigenetic regulation [review] PMID: 21865592
  12. In comparison with the healthy gingiva, the expression of Doc-1 was decreased, whereas the expression of S100A7 was upregulated in all oral lesions. PMID: 21740085
  13. P12(CDK2AP1) is downregulated by miR-21 PMID: 21328460
  14. Missing down-regulation of the tumor-suppressor gene DOC-1, might exert protective effects and counteract malignant transformation of benign, proliferating lesions of the oral cavity. PMID: 21187770
  15. Data support the role of cdk2ap1 as a tumor suppressor gene that can regulate squamous cell carcinoma growth in a cell autonomous manner through decreases in invasiveness and a non-cell autonomous manner through decreases in angiogenesis phenotypes. PMID: 20541561
  16. The combination of an increased expression of the antimicrobial peptide DEFA-4, the oncogene S100-A7, epidermal growth factor, and tenascin-c, and a decreased Doc-1 expression in oral leukoplakia might characterize its potency of malignant transformation. PMID: 20727496
  17. Results indicate that DOC-1 is a bona fide subunit of the Mi-2/NuRD chromatin remodeling complex. PMID: 20523938
  18. CDK2AP1 is a novel multiple sclerosis susceptibility loci, and it's risk allele correlates with diminished RNA expression of the cell cycle regulator CDK2AP1 PMID: 20555355
  19. Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4. PMID: 19679565
  20. DOC1 has a differential expression in microsatellite-unstable human colorectal neoplasms. PMID: 13679870
  21. plays a role in TGF-beta1-mediated growth suppression by modulating CDK2 activities and pRB phosphorylation PMID: 14744761
  22. p12CDK2-AP1 forms nuclear homodimers in contact inhibited normal diploid cells and dimerization of p12 is a necessary process for the growth inhibition effect by p12 PMID: 15840587
  23. Resistance to TGF-beta 1-induced growth suppression is due to the disruption of its signaling pathway as a consequence of reduced or lost p12(CDK2-AP1). PMID: 17217620
  24. the del T poly (T) 8 observed in the 3'-UTR of the CDK2-AP1 gene in human microsatellite unstable colorectal cancer is functionally significant and results in decreased CDK2-AP1 expression PMID: 17689689
  25. expression negatively associated with a more advanced depth of tumor invasion and stage in gastric carcinoma PMID: 19279387
  26. p12CDK2-AP1 is associated with tumor progression and a poor prognosis in esophageal squamous cell carcinoma. PMID: 19513502
  27. The expression of cdk2ap1 correlated with a reduction in cellular growth, irrespective of inhibition or stimulation of androgen receptor (AR) signaling pathways PMID: 19585490

Show More

Hide All

Protein Families
CDK2AP family
Database Links

HGNC: 14002

OMIM: 602198

KEGG: hsa:8099

STRING: 9606.ENSP00000261692

UniGene: Hs.433201

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*