Recombinant Human Cyclin-dependent kinase 5 activator 1 (CDK5R1), partial

In Stock
Code CSB-EP624014HU1
Abbreviation Recombinant Human CDK5R1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CDK5R1
Uniprot No.
Research Area
Cell Biology
Alternative Names
(CDK5 activator 1)(Cyclin-dependent kinase 5 regulatory subunit 1)(TPKII regulatory subunit)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
99-307aa
Target Protein Sequence
AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human CDK5R1 protein expression involves the transfection of e.coli cells with a DNA expression vector containing the gene encoding the protein of interest (99-307aa). Following transfection, the cells are cultured to induce the expression of the desired protein. The protein is equipped with a N-terminal 6xHis tag. The recombinant Human CDK5R1 protein is collected and purified from the cell lysate through affinity purification, achieving a purity greater than 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution.
Gene References into Functions
  1. Study demonstrated that NEAT1 and HOTAIR negatively regulate CDK5R1 mRNA levels, while MALAT1 has a positive effect. PMID: 29997370
  2. the downregulation of the miR-15/107 family might have a role in the pathogenesis of AD by increasing the levels of CDK5R1/p35 and consequently enhancing CDK5 activity. PMID: 27343180
  3. It is shown that p5 binds the kinase at the same CDK5/p25 and CDK5/p35 interfaces, and is thus a non-selective competitor of both activators, in agreement with available experimental data in vitro. PMID: 27387995
  4. the minor allele of CDK5R1 3'-UTR rs735555 polymorphism was associated with increased risk for NS-ID. In conclusion, our data suggest that mutations and polymorphisms in CDK5 and CDK5R1 genes may contribute to the onset of the NS-ID phenotype PMID: 26657932
  5. Under cell-free in vitro conditions, p35 is covalently modified by SUMO1. SUMO2 is conjugated to p35 in cells. The 2 major SUMO acceptor lysines in p35 are K246 and K290. Different degrees of oxidative stress resulted in differential p35 sumoylation. PMID: 25391294
  6. Cdk5/p35 is required for motor learning and involved in long-term synaptic plasticity. PMID: 24802945
  7. Expression of p35 is upregulated in human pituitary adenomas. PMID: 24550687
  8. These results reveal a physiological role of p25 production in synaptic plasticity and memory and provide new insights into the function of p25 in Abeta-associated neurotoxicity and Alzheimer's disease-like pathology. PMID: 24725413
  9. Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators. PMID: 24085300
  10. Reduced p35 basal content and down--regulation of CDK5/p35/p25 by antipsychotics are demonstrated in postmortem prefrontal cortex of schizophrenic subjects. PMID: 22964075
  11. The present study dissects the role of 3 single nucleotide polymorphisms (rs334558 and rs6438552 of GSK3B, and rs735555 of CDK5R1) in Parkinson's disease pathogenesis among eastern Indians. PMID: 21130530
  12. p10, the N-terminal domain of p35, protects against CDK5/p25-induced neurotoxicity. PMID: 23151508
  13. The decrease in membrane-associated p35 in socially isolated transgenic mice reduces associated levels of p35, alpha-CaMKII, and GluR1 and leads to endocytosis of AMPA receptors. PMID: 21544067
  14. CDK5/p35 may represent a biomarker for prognosis in patients with non-small cell lung cancer PMID: 20354813
  15. findings indicate that miR-103 and miR-107 regulate CDK5R1 expression, allowing us to hypothesize that a miRNA-mediated mechanism may influence CDK5 activity and the associated molecular pathways PMID: 21625387
  16. This study suggested that reduced p35 expression in schizophrenia has an impact on synaptic protein expression and cognition and that these deficits can be rescued, at least in part, by the inhibition of histone deacetylase 1. PMID: 21772061
  17. Study reveals a unique role of Cdk5/p35 in activation of the major noncanonical function of EPRS, namely translational control of macrophage inflammatory gene expression. PMID: 21220307
  18. These are the first quantitative and site-specific measurements of phosphorylation of p35 PMID: 20097924
  19. both proteasomal degradation and calpain cleavage of p35 and p39 are stimulated by membrane association, which is in turn mediated via myristoylation of their p10 regions. PMID: 20518484
  20. Like p25, p29 was more stable than p39 and caused redistribution of Cdk5 in cortical neurons. Our data suggest that neurotoxic insults lead to calpain-mediated conversion of p39 to p29, which might contribute to deregulation of Cdk5. PMID: 11784720
  21. cleavage of p35 to p25 greatly enhances the kinase activity of CDK5 and increases the phosphorylation of Ser(202)/Thr(205) and may play a pivotal role in neuronal cell death in Alzheimer's disease PMID: 12226093
  22. a short peptide (amino acid residues 154-279; Cdk5 inhibitory peptide; CIP), derived from p35, specifically inhibits Cdk5 activity in vitro and in HEK293 cells cotransfected with the peptide and Cdk5/p25, but had no effect on endogenous cdc2 kinase PMID: 12230554
  23. p25-Cdk5 is responsible for the mitotic-like phosphoepitopes present in neurofibrillary tangles PMID: 12826674
  24. Neither the CDK5 activator p25 immunoreactivity nor the p25/p35 ratio was elevated in Alzheimer disease brains or in other tauopathies (n = 34) compared with controls (n = 11) PMID: 12859671
  25. Expression of p35 and CDK5 in insulin-producing beta-cellsis new signaling pathway controlled by glucose, and its functional role may comprise regulation of various biological processes in beta-cells, such as expression of the insulin gene. PMID: 14976144
  26. These results suggest that Cdk5/p35 and p25 are novel players in digoxin-triggered prostate cancer cell apoptosis and, therefore, become potential therapeutic targets. PMID: 15123618
  27. significantly lower levels of cyclin-dependent kinase 5, regulatory subunit 1 (p35) gene transcripts were detected in gangliogliomas compared to controls PMID: 15175076
  28. CK2 acts as an inhibitor of Cdk5 in the brain PMID: 15342635
  29. data suggest that Cyclin-dependent kinase 5 (Cdk5)-Cdk5 activator p35 is required to elicit the maximum GTP-induced secretory response from neutrophils PMID: 15492003
  30. Cdk5 activity and p35 translocation in the ventral striatum were upregulated in methamphetamine sensitized rats. PMID: 15536496
  31. an early event in neuronal cell death is p25/Cdk5-mediated retinoblastoma phosphorylation PMID: 15741232
  32. role of the CDK5 molecular complex in the genetic etiology of early-onset Alzheimer disease; a yet unknown functional variant in CDK5 or in a nearby gene might lead to increased susceptibility for early onset Alzheimer disease PMID: 15917097
  33. molecular analysis of the CDK5/p25 and CDK2/cyclin A systems PMID: 16407256
  34. novel mutations and novel polymorphisms in coding regions and 3'UTR were detected in patients with with non-syndromic mental retardation PMID: 16425041
  35. Cdk5 and Erk1/2 kinases share some common substrates but impact of their cross talk on tau phosphorylation has not previously been demonstrated. PMID: 16678793
  36. nestin is a survival determinant whose action is based upon a novel mode of Cdk5 regulation, affecting the targeting, activity, and turnover of the Cdk5/p35 signaling complex PMID: 17036052
  37. p35 employs pathways distinct from that used by Cdk5 for transport to the nucleus PMID: 17060323
  38. phosphorylation of Thr(138) predominantly defines the susceptibility of p35 to calpain-dependent cleavage and dephosphorylation of this site is a critical determinant of Cdk5-p25-induced cell death associated with neurodegeneration PMID: 17121855
  39. p35 is a microtubule-associated protein that modulates microtubule dynamics PMID: 17491008
  40. Increased expression of Cdk5 was seen in stroke-affected tissue, with about a third showing increased p35 and p25 cleaved fragment. Increased Cdk5-, p-Cdk5- and p35-positive neurons and microvessels occurred in stroke-affected regions. PMID: 17493033
  41. This experiment demonstrate increased immunoreactivity for the activators of cyclin-dependent kinase 5 in post-mortem human hippocampi affected by the neurodegenerative condition hippocampal sclerosis. PMID: 17496813
  42. the involvement of 3'-UTR in the modulation of CDK5R1 expression PMID: 18053171
  43. Data demonstrate that a decrease in the level of Egr-1, one of the targets for MAPK, by Tat has a negative impact on the level of p35 expression in NGF-treated neural cells. PMID: 18247371
  44. p35 co-expression targets E-cadherin to lysosomes and p35-triggered disappearance of E-cadherin precursor can be blocked specifically by lysosomal protease inhibitors, indicating p35 induces endocytosis and subsequent degradation of precursor E-cadherin PMID: 18325333
  45. p25 and cyclin-dependent kinase 5 play important roles as mediators of dopamine and glutamate in the neurotoxicity associated with Huntington's disease. PMID: 18829967
  46. Subjects carrying both the CDK5R1 (3'-UTR, rs735555) AA genotype and the GSK-3beta (-50, rs334558) CC genotype had a 12.5-fold decrease in Alzheimer disease risk suggesting synergistic effects (epistasis) between both genes PMID: 19154537
  47. a role for Cdk5-p35 as a survival factor in countering MPP+-induced neuronal cell death. PMID: 19638632
  48. Performed functional studies in mouse. PMID: 9010203

Show More

Hide All

Subcellular Location
[Cyclin-dependent kinase 5 activator 1, p35]: Cell membrane; Lipid-anchor; Cytoplasmic side. Cell projection, neuron projection.; [Cyclin-dependent kinase 5 activator 1, p25]: Nucleus. Cytoplasm, perinuclear region. Perikaryon.
Protein Families
Cyclin-dependent kinase 5 activator family
Tissue Specificity
Brain and neuron specific.
Database Links

HGNC: 1775

OMIM: 603460

KEGG: hsa:8851

STRING: 9606.ENSP00000318486

UniGene: Hs.500015

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*