Recombinant Human Cyclin-dependent kinase inhibitor 3 (CDKN3)

Code CSB-YP005096HU
Abbreviation Recombinant Human CDKN3 protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CDKN3
Uniprot No.
Research Area
Cell Biology
Alternative Names
CDI1; Cdk associated protein phosphatase; CDK2 associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; CDKN3; CDKN3_HUMAN; CIP2; Cyclin dependent kinase inhibitor 3; Cyclin dependent kinase interacting protein 2; Cyclin dependent kinase interactor 1; Cyclin-dependent kinase inhibitor 3; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; FLJ25787; KAP; KAP1; Kinase associated phosphatase; Kinase-associated phosphatase; MGC70625; OTTHUMP00000178991
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-212aa
Target Protein Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
Gene References into Functions
  1. Results demonstrate that upregulation of p27 is involved in the knockdown of CDKN3-induced decrease in cell proliferation, increase in cell cycle arrest and apoptosis, decrease in invasion, and increase in radiosensitivity. PMID: 28109073
  2. the mechanism of CDKN3 overexpression in human cancer PMID: 28504190
  3. CDKN3 is frequently upregulated in gastric cancer tissues and cell lines and is related to advanced clinical stage, recurrence, and poor clinical outcome in gastric cancer. The functional data strongly suggest that CDKN3 behaves as an oncogene in gastric cancer, and downregulation of CDKN3 could inhibit gastric cancer cell proliferation, migration, and invasion, and induce cell cycle arrest and apoptosis. PMID: 27983933
  4. CDKN3 may act as a tumor suppressor in liver tissues by modulation of the cell survival signal transduction, monitoring carcinogenesis and elimination of abnormal cells. PMID: 27314282
  5. These results suggest that CDKN3 acts as an oncogene during breast cancer progression. The in vitro silencing of CDKN3 promoted apoptosis, induced G1 phase cell cycle arrest and inhibited cell migration. PMID: 27314680
  6. Knockdown of Cdkn3 stabilizes Mps1 at centrosomes. PMID: 26586430
  7. CDKN3 mRNA may be a good survival biomarker and potential therapeutic target in cervical cancer PMID: 26372210
  8. CDKN3 overexpression in lung adenocarcinoma is not attributed to alternative splicing or mutation but is likely due to increased mitotic activity, arguing against CDKN3 as a tumour suppressor PMID: 26554648
  9. CDKN3 knockdown reduces cell proliferation, invasion and promotes apoptosis in human ovarian cancer cells. PMID: 26191143
  10. These results highlight the importance of CDKN3 in Bcr-Abl-mediated leukemogenesis. PMID: 25360622
  11. High CDKN3 expression is associated with colorectal cancer. PMID: 25735390
  12. these data identify KAP as a major regulator of cell division via interactions with numerous target proteins. aberrant splicing or miR-26a decreases KAP expression to promote glioblastoma growth and invasion. PMID: 24704824
  13. CDKN3 may play an important role in the development and proliferation of epithelial ovarian cancer PMID: 24573179
  14. KAP is overexpressed in alcohol-related hepatocellular carcinoma. PMID: 23292002
  15. RelB activation is key for promoting multiple myeloma cell survival through the upregulation of anti-apoptotic proteins, in particular, CIAP2. PMID: 23555623
  16. CDKN3 controls mitosis through the CDC2 signaling axis. PMID: 23775190
  17. High CDKN3 expression is associated with cervical cancer. PMID: 23405241
  18. cyclin-dependent kinase-associated protein phosphatase expression was associated with poorly differentiated Renal cell carcinoma PMID: 21396835
  19. These results suggest that CDKN3 acts as an oncogene in human hepatocellular carcinoma and antagonism of CDKN3 may be of interest for the treatment of HCC. PMID: 22390936
  20. analysis of CDKN3 cell cycle networks and the molecular mechanism of non-malignancy associated hepatitis/cirrhosis and HCC transformation PMID: 21535270
  21. Identification of a KAP domain that interacts with cyclin-dependent kinase 2. PMID: 12745075
  22. In choline-deficient neuroblastoma cells, the promoter of the cyclin-dependent kinase inhibitor 3 gene (CDKN3) was hypomethylated. This was associated with increased expression of CDKN3 gene product kinase-associated phosphatase (KAP) PMID: 15147518
  23. Pax3 represses transcription through a novel mechanism involving competition between corepressor KAP1 and the heterochromatin-binding protein HP1gamma PMID: 16945326
  24. the reduction of KAP1 levels promotes p53-dependent p21 induction and inhibits cell proliferation in actinomycin D-treated cells. PMID: 17056014

Show More

Hide All

Involvement in disease
Hepatocellular carcinoma (HCC)
Subcellular Location
Cytoplasm, perinuclear region.
Protein Families
Protein-tyrosine phosphatase family
Database Links

HGNC: 1791

OMIM: 114550

KEGG: hsa:1033

STRING: 9606.ENSP00000335357

UniGene: Hs.84113

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*