Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CSTA

Uniprot No.

P01040

Research Area

Cancer

Alternative Names

(Cystatin-AS)(Stefin-A)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-98aa

Target Protein Sequence

IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

38.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human CSTA was expressed with the amino acid range of 2-98. The expected molecular weight for the CSTA protein is calculated to be 38.3 kDa. This CSTA protein is produced using e.coli expression system. The CSTA coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant CSTA protein in following stages of expression and purification.

Human cystatin-A (CSTA), also known as stefin A, is a member of the cystatin superfamily of cysteine proteinase inhibitors. CSTA plays a crucial role in regulating the activity of cysteine proteases by forming tight, reversible complexes with them. CSTA is primarily expressed in the epidermis, where it helps control the activity of proteases involved in skin homeostasis. Its inhibition of cathepsins protects against excessive protein degradation, contributing to the maintenance of skin integrity. Beyond its role in skin physiology, CSTA has been implicated in various pathological conditions, including cancer, where its dysregulation may influence tumor progression. Understanding CSTA's functions is vital for unraveling its diverse roles in health and disease.

Target Background

Function

This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis.

Gene References into Functions

High levels of CSTA expression in Esophageal Squamous Cell Carcinoma were correlated with tumor progression and advanced cancer stage, including lymph node metastasis. PMID: 29642180
UV phototoxicity-induced pre-elafin inside keratinocytes prior to cornified envelope formation could be involved in UV-induced keratinocyte apoptosis via cystatin-A downregulation resulting in pro-caspase-3 activation. PMID: 28119996
Identify myoepithelial cell stefin A as a suppressor of early tumor invasion and a candidate marker to distinguish patients who are at low risk of developing invasive breast cancer. PMID: 29086922
Expression of CSTA was detected in some tumor tissues and many tumor-infiltrating immune cells. Cathepsin B expression was also observed in most tumor tissues and tumor-infiltrating immune cells PMID: 28898495
The results suggest that C12orf39, CSTA, and CALCB are novel ATF4 target genes, and that C12orf39 promoter activity is activated by ATF4 through amino acid response element. PMID: 26967115
CSTA/TYROBP gene interaction might play pivotal roles in the occurrence and development of Postmenopausal Osteoporosis . PMID: 26676054
High expression of stefin A may be an important factor contributing to the development and metastasis of Hepatocellular Carcinoma. PMID: 26753874
Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients. PMID: 26634210
a novel pathway of CSTA regulation involving Dsg2 PMID: 25785582
We identified a homozygous nonsense mutation (p.Lys22X) in the CSTA gene in acral peeling skin syndrome. PMID: 23534700
High levels of bioactive recombinant stefins A and B can be produced by fermentation in P. pastoris. PMID: 23656633
Data indicate that desmoplakin (DSP) and cystatin A (CSTA) interaction and insulin-like growth factor 1 (IGF-1), IGF-binding protein 7 (IGFBP7) and syndecan 1 (SDC1) interaction were observed in protein-protein interaction (PPI) network. PMID: 23546957
Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway PMID: 22787201
findings provide a new molecular understanding of the mechanisms of MYOC-causative glaucoma and reveal CSTA, a serum biomarker for cancer, as a potential biomarker and drug for the treatment of MYOC-induced glaucoma PMID: 22615763
study identified loss-of-function mutations in the gene for protease inhibitor cystatin A as the underlying genetic cause of exfoliative ichthyosis PMID: 21944047
CSTA significantly increases the risk of developing psoriasis in HLA-Cw6 individuals PMID: 21412248
Findings establish that genetic variability, smoking, and COPD all influence CSTA expression, as does SCC, supporting the concept that CSTA may make pivotal contributions to NSCLC pathogenesis in early and late stages of disease development. PMID: 21325429
A higher pretreated serum level of cystatin A was found to be associated with a higher nodal stage and poorer prognosis of nasopharyngeal carcinoma patients. PMID: 20461718
Up-regulation of stefin A, an endogenous inhibitor of cathepsin S, was found in inverted papilloma tissues as compared with its expression level in normal sinus mucosa tissues. PMID: 21038029
Cystatin A binds reduced forms of mite group 1 allergens Der f 1 and Der p 1, in which the cysteine residue at the catalytic center of the protease activity is reduced by treatment with L-cysteine but does not bind oxidized forms. PMID: 19933866
crystal structure in complex with cathepsin H PMID: 12581647
The 1,25(OH)(2)D3-responsive element in cystatin A gene is identical to TRE, T2 (-272 to -278). Suppression of Raf-1/MEK1/ERK1,2 signaling pathway increases cystatin A expression of normal human keratinocytes. PMID: 12682854
backbone dynamics of the monomeric and domain-swapped dimeric forms of stefin A by (15)N relaxation using a model-free approach PMID: 14747998
By using ThT fluorescence, X-ray diffraction, and atomic force microscopy (AFM), it has been shown that human stefins A and B (subfamily A of cystatins) form amyloid fibrils PMID: 15048832
No association with psoriasis susceptibility PMID: 15175029
Chimeras of stefinA and B have been prepared and guanidine denaturation curves and folding rates have been examined. PMID: 16342276
only stefins A and B, i.e. type I cystatins, are up-regulated in lung tumours and thus able to counteract harmful tumour-associated proteolytic activity PMID: 16969475
Cystatin A suppresses UVB-induced apoptosis of keratinocytes by the inhibition of caspase 3 activation. PMID: 17412564
+344C allele associated with unstable mRNA could result in failing to protect the skin barrier in atopic dermatitis patients from both exogenous and endogenous proteases. PMID: 17441792
We conclude that Stefin A expression reduces distant metastasis in breast cancer and propose that this may be due to the inhibition of cysteine cathepsins, such as cathepsin B. PMID: 17985332
CSTA TCC haplotype is only associated with psoriasis in those individuals carrying the risk allele at the HLA-Cw6 locus PMID: 18364739
expression of cystatin A is regulated via mitogen-activated protein kinase pathways positively by Ras/MEKK1/MKK7/JNK and negatively by Ras/Raf/MEK1/ERK. PMID: 11451947

Hide All

Involvement in disease

Peeling skin syndrome 4 (PSS4)

Subcellular Location

Cytoplasm.

Protein Families

Cystatin family

Tissue Specificity

Expressed in the skin throughout the epidermis.

Database Links

HGNC: 2481

OMIM: 184600

KEGG: hsa:1475

STRING: 9606.ENSP00000264474

UniGene: Hs.518198

Code	CSB-EP006099HU
Abbreviation	Recombinant Human CSTA protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Cystatin-A (CSTA)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage