Recombinant Human Cystatin-A (CSTA)

In Stock
Code CSB-EP006099HU
Abbreviation Recombinant Human CSTA protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
CSTA
Uniprot No.
Research Area
Cancer
Alternative Names
(Cystatin-AS)(Stefin-A)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-98aa
Target Protein Sequence
IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human CSTA was expressed with the amino acid range of 2-98. The expected molecular weight for the CSTA protein is calculated to be 38.3 kDa. This CSTA protein is produced using e.coli expression system. The CSTA coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant CSTA protein in following stages of expression and purification.

Human cystatin-A (CSTA), also known as stefin A, is a member of the cystatin superfamily of cysteine proteinase inhibitors. CSTA plays a crucial role in regulating the activity of cysteine proteases by forming tight, reversible complexes with them. CSTA is primarily expressed in the epidermis, where it helps control the activity of proteases involved in skin homeostasis. Its inhibition of cathepsins protects against excessive protein degradation, contributing to the maintenance of skin integrity. Beyond its role in skin physiology, CSTA has been implicated in various pathological conditions, including cancer, where its dysregulation may influence tumor progression. Understanding CSTA's functions is vital for unraveling its diverse roles in health and disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis.
Gene References into Functions
  1. High levels of CSTA expression in Esophageal Squamous Cell Carcinoma were correlated with tumor progression and advanced cancer stage, including lymph node metastasis. PMID: 29642180
  2. UV phototoxicity-induced pre-elafin inside keratinocytes prior to cornified envelope formation could be involved in UV-induced keratinocyte apoptosis via cystatin-A downregulation resulting in pro-caspase-3 activation. PMID: 28119996
  3. Identify myoepithelial cell stefin A as a suppressor of early tumor invasion and a candidate marker to distinguish patients who are at low risk of developing invasive breast cancer. PMID: 29086922
  4. Expression of CSTA was detected in some tumor tissues and many tumor-infiltrating immune cells. Cathepsin B expression was also observed in most tumor tissues and tumor-infiltrating immune cells PMID: 28898495
  5. The results suggest that C12orf39, CSTA, and CALCB are novel ATF4 target genes, and that C12orf39 promoter activity is activated by ATF4 through amino acid response element. PMID: 26967115
  6. CSTA/TYROBP gene interaction might play pivotal roles in the occurrence and development of Postmenopausal Osteoporosis . PMID: 26676054
  7. High expression of stefin A may be an important factor contributing to the development and metastasis of Hepatocellular Carcinoma. PMID: 26753874
  8. Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients. PMID: 26634210
  9. a novel pathway of CSTA regulation involving Dsg2 PMID: 25785582
  10. We identified a homozygous nonsense mutation (p.Lys22X) in the CSTA gene in acral peeling skin syndrome. PMID: 23534700
  11. High levels of bioactive recombinant stefins A and B can be produced by fermentation in P. pastoris. PMID: 23656633
  12. Data indicate that desmoplakin (DSP) and cystatin A (CSTA) interaction and insulin-like growth factor 1 (IGF-1), IGF-binding protein 7 (IGFBP7) and syndecan 1 (SDC1) interaction were observed in protein-protein interaction (PPI) network. PMID: 23546957
  13. Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway PMID: 22787201
  14. findings provide a new molecular understanding of the mechanisms of MYOC-causative glaucoma and reveal CSTA, a serum biomarker for cancer, as a potential biomarker and drug for the treatment of MYOC-induced glaucoma PMID: 22615763
  15. study identified loss-of-function mutations in the gene for protease inhibitor cystatin A as the underlying genetic cause of exfoliative ichthyosis PMID: 21944047
  16. CSTA significantly increases the risk of developing psoriasis in HLA-Cw6 individuals PMID: 21412248
  17. Findings establish that genetic variability, smoking, and COPD all influence CSTA expression, as does SCC, supporting the concept that CSTA may make pivotal contributions to NSCLC pathogenesis in early and late stages of disease development. PMID: 21325429
  18. A higher pretreated serum level of cystatin A was found to be associated with a higher nodal stage and poorer prognosis of nasopharyngeal carcinoma patients. PMID: 20461718
  19. Up-regulation of stefin A, an endogenous inhibitor of cathepsin S, was found in inverted papilloma tissues as compared with its expression level in normal sinus mucosa tissues. PMID: 21038029
  20. Cystatin A binds reduced forms of mite group 1 allergens Der f 1 and Der p 1, in which the cysteine residue at the catalytic center of the protease activity is reduced by treatment with L-cysteine but does not bind oxidized forms. PMID: 19933866
  21. crystal structure in complex with cathepsin H PMID: 12581647
  22. The 1,25(OH)(2)D3-responsive element in cystatin A gene is identical to TRE, T2 (-272 to -278). Suppression of Raf-1/MEK1/ERK1,2 signaling pathway increases cystatin A expression of normal human keratinocytes. PMID: 12682854
  23. backbone dynamics of the monomeric and domain-swapped dimeric forms of stefin A by (15)N relaxation using a model-free approach PMID: 14747998
  24. By using ThT fluorescence, X-ray diffraction, and atomic force microscopy (AFM), it has been shown that human stefins A and B (subfamily A of cystatins) form amyloid fibrils PMID: 15048832
  25. No association with psoriasis susceptibility PMID: 15175029
  26. Chimeras of stefinA and B have been prepared and guanidine denaturation curves and folding rates have been examined. PMID: 16342276
  27. only stefins A and B, i.e. type I cystatins, are up-regulated in lung tumours and thus able to counteract harmful tumour-associated proteolytic activity PMID: 16969475
  28. Cystatin A suppresses UVB-induced apoptosis of keratinocytes by the inhibition of caspase 3 activation. PMID: 17412564
  29. +344C allele associated with unstable mRNA could result in failing to protect the skin barrier in atopic dermatitis patients from both exogenous and endogenous proteases. PMID: 17441792
  30. We conclude that Stefin A expression reduces distant metastasis in breast cancer and propose that this may be due to the inhibition of cysteine cathepsins, such as cathepsin B. PMID: 17985332
  31. CSTA TCC haplotype is only associated with psoriasis in those individuals carrying the risk allele at the HLA-Cw6 locus PMID: 18364739
  32. expression of cystatin A is regulated via mitogen-activated protein kinase pathways positively by Ras/MEKK1/MKK7/JNK and negatively by Ras/Raf/MEK1/ERK. PMID: 11451947

Show More

Hide All

Involvement in disease
Peeling skin syndrome 4 (PSS4)
Subcellular Location
Cytoplasm.
Protein Families
Cystatin family
Tissue Specificity
Expressed in the skin throughout the epidermis.
Database Links

HGNC: 2481

OMIM: 184600

KEGG: hsa:1475

STRING: 9606.ENSP00000264474

UniGene: Hs.518198

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*