Recombinant Human Cytochrome c-type heme lyase(HCCS)

Code CSB-EP010165HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P53701
Relevance Links covalently the heme group to the apoprotein of cytochrome c.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Holocytochrome c-type synthase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Research Area Cardiovascular
Source E.coli
Gene Names HCCS
Protein Names Recommended name: Cytochrome c-type heme lyase Short name= CCHL EC= 4.4.1.17 Alternative name(s): Holocytochrome c-type synthase
Expression Region 1-268aa
Tag Info N-terminal GST-tagged
Mol. Weight 57.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Links covalently the heme group to the apoprotein of cytochrome c.
Involvement in disease Linear skin defects with multiple congenital anomalies 1 (LSDMCA1)
Subcellular Location Mitochondrion inner membrane, Membrane, Lipid-anchor
Protein Families Cytochrome c-type heme lyase family
Database Links

HGNC: 4837

OMIM: 300056

KEGG: hsa:3052

STRING: 9606.ENSP00000326579

UniGene: Hs.211571

Related Products

HCCS Antibodies

HCCS Antibodies for Homo sapiens (Human)

HCCS Antibodies for Human

HCCS Proteins

HCCS Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.