Recombinant Human D-amino acid oxidase activator (DAOA)

Code CSB-EP006495HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DAOA
Uniprot No.
Research Area
Others
Alternative Names
D-amino acid oxidase activator; DAOA; DAOA_HUMAN; G72 transcript; LG72; Protein G72; Schizophrenia and bipolar disorder associated protein G72; SG72
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-153aa
Target Protein Sequence
MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
45.1kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to activate D-amino acid oxidase.
Gene References into Functions
  1. Findings showed that NOS1AP (rs348624, rs12742393 and rs1415263), DISC1 (rs821633 and rs1000731), DAOA (rs2391191) and GSK3B (rs6438552) SNPs had no association with development of early-onset schizophrenia; however, our finding suggested statistically significant role of the interaction of NOS1AP, DISC1, DAOA and GSK3B polymorphisms in schizophrenia susceptibility. PMID: 29100974
  2. In SNP-based single locus association analyses, the rs778292 in the DAOA gene showed significant association with schizophrenia. Additionally, a three-SNP haplotype (rs778292-rs3918342-rs1421292) in the DAOA gene were observed to be significantly associated with schizophrenia in a Taiwanese population. PMID: 28285246
  3. G72 transgenic mice have larger excitatory synapses with an increased amount of N-methyl-d-aspartate (NMDA) receptors in the molecular layer of dentate gyrus, compared with wild-type littermates. Transgenic animals have lower number of dentate granule cells with a parallel, but an even stronger decrease in the number of excitatory synapses in the molecular layer. PMID: 27163208
  4. pLG72 interacts with neosynthesized d-amino acid oxidase (hDAAO), promoting its inactivation and degradation. In this work, we used low-resolution techniques to characterize the surface topology of the hDAAO-pLG72 complex. PMID: 27400736
  5. Data show that the R30K D-amino acid oxidase activator pLG72 is significantly more prone to degradation than the R30 and the K62E variants in a cell system. PMID: 28166363
  6. Studies successfully predicted the structures of the N- and C-terminal domains (ND and CD, respectively) of G72. PMID: 27815320
  7. We suggest that serum G72 protein levels may represent a candidate biomarker for schizophrenia and have confirmed the results of the previous preliminary study. PMID: 27412497
  8. A Mutation in DAOA Modifies the Age of Onset in PSEN1 E280A Alzheimer's Disease. Findings strongly suggest that this new conspicuous functional age of onset modifier within the G72 (DAOA) gene could be pivotal for understanding the genetic basis of Alzheimer's disease. PMID: 26949549
  9. DAOA gene may contribute to the risk for Psychotic disorders and that this gene may play a role as a modulator of executive function. PMID: 26803614
  10. pLG72 level being significantly increased in the serum of patients with schizophrenia, have led us to propose that the ROS enhancement in mental diseases may be from the overexpression of pLG72 in brain cells. PMID: 26539492
  11. Report in silico analysis of DAOA for the design of inhibitors for treatment of schizophrenia. PMID: 26170631
  12. There were no regions with significantly reduced FA values in homozygous risk allele carriers. PMID: 25031104
  13. This study suggested that structural lipid alterations in oligodendrocyte glycosynapses are responsible for dysconnectivity in schizophrenia and that increased expression of G72 protein may play a role in the development of abnormal glycosynapses. PMID: 25263995
  14. DAOA (or G72) gene encodes for a protein that binds to and activates the D-serine amino acid oxidase that acts as a coactivator of the glycine binding site on the glutamatergic N-methyl D-aspartate (NMDA) receptor. PMID: 25043320
  15. the mitochondrial methionine-R-sulfoxide reductase B2 (MSRB2) is a specific interaction partner of LG72. PMID: 25078755
  16. DAOA genetic polymorphism were not found to confer a statistically significant increased risk of Schizophrenia, bipolar disorder or depressive disorder. PMID: 24447945
  17. Suggest chronic nicotine administration improves cognitive symptoms in G72 mouse model of schizophrenia. PMID: 24417347
  18. study reports G72/G30 expression profiles and behavioral changes in a G72/G30 transgenic mouse model; the transcriptome profile changes and multiple mouse behavioral effects suggest that the G72 gene may play a role in modulating behaviors relevant to psychiatric disorders PMID: 23337943
  19. Its toxic effect on motor neurons can be mediated by expression in motor neurons and it promotes autophagy. PMID: 24138986
  20. Results demonstrate that expression of the human G72/G30 gene locus in mice produces behavioral phenotypes that are relevant to schizophrenia and implicate LG72-induced mitochondrial and synaptic defects as a possible pathomechanism of this disease. PMID: 23092656
  21. Data suggest that neuronal LG72 exhibits a rapid turnover (half-life of 25-40 min in U87 glioblastoma cells) and is degraded via proteasome system, albeit not ubiquitinated. PMID: 24237903
  22. No significant epistatic interaction was observed between DAOA and 5HTR1A variants on clinical outcomes in patients with schizophrenia PMID: 23495896
  23. Significant interactions between the effects of G72 and DAT polymorphisms on activation were evident in several brain areas PMID: 22438288
  24. Cognitive manic symptoms in bipolar disorder associated with polymorphisms in the DAOA and COMT genes. PMID: 23861766
  25. htSNPs not associated with transition to psychosis in high risk individuals PMID: 23632455
  26. the DAOA gene may confer genetic risk of schizophrenia. PMID: 23335491
  27. primary analyses of the 6 DAOA gene polymorphisms failed to detect any association with schizophrenia PMID: 23497497
  28. docking experiment demonstrated DAOA is involved in major amino acid interactions: the residues that interact strongly with the ligand C28H28N3O5PS2 are polar but uncharged (Gln36, Asn38, Thr 122) and non-polar hydrophobic (Ile119, Ser171, Ser21, Ala31). PMID: 23286827
  29. The results of this study suggested that DAOA gene variation affects dopamine turnover in healthy individuals. PMID: 22454242
  30. The DAOA gene may confer genetic risk of major depression. PMID: 22851402
  31. This study reveled the functional role of the LG72 protein and pinpoints molecular correlates of schizophrenia-like behavior. PMID: 22884423
  32. Psychosis and relapse in bipolar disorder are related to GRM3, DAOA, and GRIN2B genotype in Caucasian and mixed-ancestry South African pilot study. PMID: 20957330
  33. A significant 3 way interaction between G72, DAAO and diagnosis is detected in the right middle temporal gyrus (after family-wise error correction), accounting for 8.5% of the individual variance in activation. PMID: 22239582
  34. The findings suggest that the DAOA single nucleotide polymorphisms investigated may not affect major depressive disorder or bipolar disorder phenotype, clinical symptoms or other clinical factors. PMID: 22429365
  35. Results suggested that DAOA rs7139958 and rs9558571 SNPs may be associated with more severe baseline positive symptoms in patients with schizophrenia. PMID: 22122005
  36. The Arg30Lys DAOA risk variant is associated with a distinct cortical thinning, providing new evidence for the pathophysiological impact of DAOA in schizophrenia. PMID: 21508934
  37. G72 transgenic mice have reduced activity of mitochondrial complex I, with a concomitantly increased production of reactive oxygen species. PMID: 21716263
  38. Data suggest that newly synthesized D-amino acid oxidase colocalizes and interacts with pLG72 which appears to be exposed on the external membrane of mitochondria. PMID: 21679769
  39. The results of this study suggested that deleterious genotypes for DAOA and COMT might contribute to the pathophysiology of schizophrenia. PMID: 21215384
  40. This study suggested that DAOA/G72 gene confers susceptibility to both bipolar disorder and schizophrenia , but that different polymorphisms may potentially differentiate between these two disorders. PMID: 21443574
  41. G72 genotype does modulate brain activation during language production on a semantic level in key language areas. PMID: 20336655
  42. The present data do not support the view of a general modulatory role of G72 on medial temporal lobe brain activity, at least not in the domain of long-term memory encoding and retrieval. PMID: 20005295
  43. variation in G72 modulates the progressive brain changes that characterize schizophrenia PMID: 19760675
  44. Observational study of gene-disease association. (HuGE Navigator) PMID: 20712760
  45. Observational study of gene-disease association. (HuGE Navigator) PMID: 20957330
  46. Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 21041608
  47. This study did not find DAOA significant associations with schizophrenia. Thus, DAOA genes do not fit the antagonistic pleiotropy model. PMID: 20483474
  48. multivariate regression showed that the rs2153674 genotype accounts for up to 15% of the variance in delusions severity in patients with Alzheimer's disease PMID: 20009237
  49. Observational study of gene-disease association. (HuGE Navigator) PMID: 20667145
  50. The results of thisn study demonistrated that in individuals with Schizophrenia who carrying rs2391191 A allele had significantly lower brief psychiatric rating scale scores than subjects carrying the G allele at each time point. PMID: 20471098

Show More

Hide All

Involvement in disease
Schizophrenia (SCZD)
Subcellular Location
Golgi apparatus.
Tissue Specificity
Expressed in amygdala, caudate nucleus, spinal cord and testis.
Database Links

HGNC: 21191

OMIM: 181500

KEGG: hsa:267012

STRING: 9606.ENSP00000365103

UniGene: Hs.381382

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*