Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
AN11; Dcaf7; DCAF7_HUMAN; DDB1- and CUL4-associated factor 7; HAN11 ; Human anthocyanin; Petunia; Seven WD repeat protein of the AN11 family 1; SWAN 1; WD repeat domain 68; WD repeat protein An11 homolog ; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; WDR68
Species
Homo sapiens (Human)
Expression Region
1-342aa
Target Protein Sequence
MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human DCAF7 was expressed with the amino acid range of 1-342. The expected molecular weight for the DCAF7 protein is calculated to be 54.9 kDa. This DCAF7 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of DCAF7, which enables a simple process of detecting and purifying the DCAF7 recombinant protein in the following steps.
The human DDB1- and CUL4-associated factor 7 (DCAF7) is a protein involved in the formation of the CUL4-based E3 ubiquitin ligase complexes. These complexes play a crucial role in ubiquitin-mediated protein degradation, a process essential for regulating various cellular functions. DCAF7, as part of these complexes, contributes to substrate recognition and targeting for ubiquitination. The ubiquitin-proteasome system, in which DCAF7 participates, is involved in controlling the degradation of proteins, thereby influencing cell cycle progression, DNA repair, and other cellular processes. Understanding the role of DCAF7 provides insights into the intricate regulatory mechanisms governing protein stability and cellular homeostasis.
