Recombinant Human DNA primase small subunit(PRIM1)

Code CSB-EP018680HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P49642
Relevance DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias DNA primase 49 kDa subunit Short name: p49
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
Research Area Others
Source E.coli
Gene Names PRIM1
Protein Names Recommended name: DNA primase small subunit EC= 2.7.7.- Alternative name(s): DNA primase 49 kDa subunit Short name= p49
Expression Region 1-420aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 65.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
Protein Families Eukaryotic-type primase small subunit family
Database Links

HGNC: 9369

OMIM: 176635

KEGG: hsa:5557

STRING: 9606.ENSP00000350491

UniGene: Hs.534339

Related Products

PRIM1 Antibodies

PRIM1 Antibodies for Homo sapiens (Human)

PRIM1 Proteins

PRIM1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.