Recombinant Human Disabled homolog 1 (DAB1)

Code CSB-EP006479HU
Abbreviation Recombinant Human DAB1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
DAB1
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-588aa
Target Protein Sequence
MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
70.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adapter molecule functioning in neural development. May regulate SIAH1 activity.
Gene References into Functions
  1. In intestine a truncated Dab1 variant transmits the reelin signal and may play a role in clathrin-mediated apical endocytosis and in the control of cell-to-cell junction assembly. Dab1 variant may be a nucleocytoplasmic shuttling protein, inferred from its sequence and nuclear location. PMID: 29470947
  2. these results establish an unstable repeat insertion in DAB1 as a cause of cerebellar degeneration. PMID: 28686858
  3. Study shows that early neural cells transiently express Reelin at the time they leave the presumptive olfactory/vomeronasal epithelium and that Dab 1 is present in the migratory cell mass and in the presumptive ensheathing cells in the absence of reelin. PMID: 26270645
  4. this study is the first to provide genetic evidence for DAB1 as a candidate AD liability/protection gene, although the strength of the contribution of DAB1 may differ among populations PMID: 26028559
  5. results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS. PMID: 24844606
  6. The finding of this study suggested that variations in DAB1 involved in the Reelin signaling pathway might contribute to genetic susceptibility to autism with Chinese Han decent. PMID: 23333377
  7. Variation in genes encoding proteins at the gateway of Reelin signaling: ligands RELN and APOE, their common receptors APOER2 and VLDLR, and adaptor DAB1, was examined. PMID: 22419519
  8. show that Reelin-stimulated Notch-1 activation is dependent on Reelin signaling PMID: 22394407
  9. alternative splicing of Dab1 is conserved in avian and mammalian species, with Dab1-L driving SFK phosphorylation in both species PMID: 22163036
  10. we report for the first time, that DAB1 is significantly up-regulated in human frontal cortex brain samples of Alzheimer disease patients PMID: 21453247
  11. Dab1, an essential component of the reelin pathway, is required for glia-independent somal translocation in the neocortex. PMID: 21315259
  12. Fe65 and Dab1 compete for binding to APP. Dab1 significantly decreased the amount of APP bound to LRP and the level of secreted APP and APP-CTF in LRP expressing cells PMID: 20568118
  13. Thus, the present observations suggest a correlation between Dab1 phosphorylation, Abeta deposition and PrP(sc) type in sCJD. PMID: 19853035
  14. This gene, is an intracellular adaptor of the Reelin pathway and reveals unusual complexity in human and mouse. PMID: 12446734
  15. involvement of disabled homolog 1 in neurogenesis PMID: 12581169
  16. RELN and DAB1 coexpression in these neurons is necessary for both normal cortical development and mature function. PMID: 12834112
  17. Dab1 immunoreactivity is found in certain populations of amacrine cells of the retina, with lobular appendages in the outer half of the inner plexiform layer (IPL) and a bushy, smooth dendritic tree in the inner half of the IPL. PMID: 14961563
  18. significantly lower levels of disabled homolog 1 gene transcripts were detected in gangliogliomas compared to controls PMID: 15175076
  19. Dab1 regulates both cell surface expression and internalization of Reelin receptors PMID: 15718228
  20. phosphoinositide-binding region within Dab1 PTB domain is required for membrane localization and basal tyrosine phosphorylation of Dab1 PMID: 15883038
  21. After Reelin binds to the receptors, Disabled-1 becomes phosphorylated on tyrosine residues, initiating a signaling cascade that includes activation of Src-family kinases and Akt. PMID: 16481437
  22. The effect of Dab1 on APP and apoEr2 processing in transfected cells and primary neurons is reported. PMID: 16951405
  23. DAB1 phosphorylation occurs solely in the segment spanning the 5th and 6th reelin repeats. PMID: 17548821
  24. Cul5 plays an essential role in regulating neuron migrations during cortical development, possibly by opposing a promigratory effect of Dab1. PMID: 17974915
  25. Resides within an unstable common fragile site region and might play a role in human tumorigenesis. PMID: 18008369
  26. Fyn, due in part to its effects on Dab1, regulates the phosphorylation, trafficking, and processing of APP and apoEr2. PMID: 18089558
  27. ligation of ApoER2 by APC signals via Dab1 phosphorylation and subsequent activation of PI3K and Akt and inactivation of GSK3beta, thereby contributing to APC's beneficial effects on cells. PMID: 19116273
  28. results suggest that the mouse ortholog is a nucleocytoplasmic shuttling protein PMID: 17062576

Show More

Hide All

Involvement in disease
Spinocerebellar ataxia 37 (SCA37)
Tissue Specificity
Mainly expressed in brain.
Database Links

HGNC: 2661

OMIM: 603448

KEGG: hsa:1600

UniGene: Hs.477370

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*