Recombinant Human Dual specificity protein phosphatase 26 (DUSP26)

In Stock
Code CSB-EP863128HU
Abbreviation Recombinant Human DUSP26 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DUSP26
Uniprot No.
Research Area
Signal Transduction
Alternative Names
DSP-4; Dual specificity phosphatase 26 (putative); Dual specificity phosphatase 26; Dual specificity phosphatase SKRP3; Dual specificity protein phosphatase 26; DUS26_HUMAN; DUSP24; DUSP26; Hypothetical protein FLJ31142; LDP 4; LDP-4; Low molecular mass dual specificity phosphatase 4; Low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; MGC1136; MGC2627; Mitogen activated protein kinase phosphatase 8; Mitogen-activated protein kinase phosphatase 8; MKP-8; MKP8; NATA1; NATA1 protein; Novel amplified gene in thyroid anaplastic cancer; SKRP3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-211aa
Target Protein Sequence
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Gene References into Functions
  1. Enhanced expression of DUSP26 was observed in the hippocampus of Alzheimer's disease patients. PMID: 26924229
  2. results suggest that AK2 is an associated activator of DUSP26 and suppresses cell proliferation by FADD dephosphorylation, postulating AK2 as a negative regulator of tumour growth. PMID: 24548998
  3. The study reports the 1.68 A crystal structure of a catalytically inactive mutant (Cys152Ser) of DUSP26 lacking the first 60 N-terminal residues (DeltaN60-C/S-DUSP26). PMID: 23298255
  4. DUSP26 may function as a tumour suppressor in particular cancers. PMID: 20347885
  5. DUSP26 functions as a p53 phosphatase PMID: 20562916
  6. DUSP26 effectively dephosphorylates p38 and has a little effect on extracellular signal-regulated kinase in anaplastic thyroid cancer. PMID: 16924234
  7. Downregulation of Dusp26 may contribute to malignant phenotypes of glioma. PMID: 19043453

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Golgi apparatus.
Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Tissue Specificity
Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
Database Links

HGNC: 28161

KEGG: hsa:78986

STRING: 9606.ENSP00000256261

UniGene: Hs.8719

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*