Code | CSB-YP019311HU |
Size | US$2474 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | RANBP2 |
Uniprot No. | P49792 |
Research Area | others |
Alternative Names | 358 kDa nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2 |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 2601-2802aa |
Target Protein Sequence | PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 24.8kDa |
Protein Length | Partial |
Tag Info | N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle |
Involvement in disease | Encephalopathy, acute, infection-induced, 3 (IIAE3) |
Subcellular Location | Nucleus, Nucleus membrane, Nucleus, nuclear pore complex, Nucleus envelope |
Protein Families | RanBP2 E3 ligase family |
Database Links |
HGNC: 9848 OMIM: 601181 KEGG: hsa:5903 STRING: 9606.ENSP00000283195 UniGene: Hs.199561 |
Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)
Express system: E.coli
Species: Escherichia coli (strain K12)
Recombinant Mouse Complement receptor type 2(Cr2),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Integrin alpha-L(Itgal),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
Express system: Yeast
Species: Mus musculus (Mouse)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide