Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial

Code CSB-YP019311HU
Abbreviation Recombinant Human RANBP2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
RANBP2
Uniprot No.
Research Area
others
Alternative Names
358 kDa nucleoporin; ANE1; E3 SUMO-protein ligase RanBP2; IIAE3; Nuclear pore complex protein Nup358; Nucleoporin 358; Nucleoporin Nup358; NUP358; p270; RAN binding protein 2; Ran-binding protein 2; RANBP2; RBP2_HUMAN; Transformation related protein 2; TRP 1; TRP 2; TRP1; TRP2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2601-2802aa
Target Protein Sequence
PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle. Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity.
Gene References into Functions
  1. We describe three in vitro reconstituted disassembly intermediates, which show binding of a Crm1 export complex via two FG-repeat patches, cargo-release by RanBP2's Ran-binding domains and retention of free Crm1 at RanBP2 after Ran-GTP hydrolysis. PMID: 27160050
  2. RAN binding protein 2 increase the sumoylation of cyclin-dependent kinase inhibitor 1B in cholangiocarcinoma cell line QBC939. PMID: 28882106
  3. Importin-beta and CRM1 control a RANBP2 spatiotemporal switch essential for mitotic kinetochore function. PMID: 28600321
  4. Translocation of p53 is regulated by androgen-dependent sumoylation mediated by the G3BP2-interacting SUMO-E3 ligase, RanBP2. G3BP2 knockdown results in reduced tumor growth and increased nuclear p53 accumulation in mouse xenograft models of prostate cancer with or without long-term androgen deprivation. PMID: 28692047
  5. These our results reveal spatio-temporal regulation in the recruitment of nucleoporins and translation factors to cytoplasmic viral factories , and particularly the importance of Nup358 in vaccinia virus infection. PMID: 28963881
  6. NUSAP1 contributes to accurate chromosome segregation by acting as a co-factor for RanBP2-RanGAP1-UBC9 during cell division. PMID: 28900032
  7. Nup358-AGO interaction is important for miRNA-mediated gene silencing and identifies SIM as a new interacting motif for the AGO family of proteins. PMID: 28039207
  8. recurrent or familial ANE without the RANBP2 mutation has a more severe outcome and greater predilection for male sex than that with the RANBP2 mutation. This suggests that there are unknown gene mutations linked to ANE. PMID: 27882739
  9. Based on the literature review of ANE1 with RANBP2 mutation, we propose a threshold for RANBP2 mutation tes PMID: 25522933
  10. findings indicate that RanGDP and not RanGTP is the physiological target for the RanBP2 SUMO E3 ligase complex PMID: 26251516
  11. Taken together, topographic and functional interactions between dynactin, importin-beta and RanBP2 are involved in nuclear translocation of IGF-1R. PMID: 24909165
  12. analysis of the RANBP2-ALK gene fusion identified in ALK-positive diffuse large B-cell lymphoma with a unique nuclear membrane staining of ALK protein PMID: 24470379
  13. Nup358, a nucleoporin that forms the cytoplasmic filaments of the nuclear pore complex, plays an important role in the nuclear import of hTERT. PMID: 24586428
  14. Our data show that Nup358 supports nuclear transport functions important for cellular homeostasis and for HIV-1 nuclear import PMID: 24586169
  15. Case Report/Review: RANBP2-ALK gene rearrangement in inflammatory myofibroblastic tumors. PMID: 24034896
  16. RANBP2-ALK fusion combined with monosomy 7 may be related to a unique clonal hematologic disorder of childhood and adolescence, characterized by myelomonocytic leukemia and a poor prognosis [case report/ review] PMID: 24613277
  17. Mitotic arrest and the following cell death were caused by depletion of RanBP2. PMID: 24113188
  18. Isomerization by NUP358 may be preserved by HIV-1 to target the nuclear pore and synchronize nuclear entry with capsid uncoating. PMID: 23902822
  19. The translation of a subset of mRNAs encoding secretory proteins is potentiated by RanBP2. PMID: 23630457
  20. These findings reveal novel roles of Ranbp2 in the modulation of intrinsic and extrinsic cell death mechanisms and pathways PMID: 23818861
  21. The structure reveals that the C-terminal domain adopts a cyclophilin-like fold with a non-canonical active-site configuration. PMID: 23353830
  22. Knockdown of RANBP2 specifically affected the late step of nuclear entry, inducing cytoplasmic granules enriched with phosphorylated components. This suggests a novel regulatory mechanism for nuclear speckle formation involving RANBP2 and phosphorylation. PMID: 22262462
  23. Nup358 functions as a cargo- and receptor-specific assembly platform, increasing the efficiency of nuclear import of proteins through various mechanisms. PMID: 21995724
  24. Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2. PMID: 22194619
  25. A critical function of RanBP2 is to capture recycling RanGTP-importin-beta complexes at cytoplasmic fibrils to allow for adequate classical nuclear localization signal-mediated cargo import. PMID: 21859863
  26. Data show that Epac1 directly interacts with the zinc fingers of RanBP2, tethering Epac1 to the nuclear pore complex, revealing a novel mechanism of Epac1 regulation and an unexpected link between the NPC and cAMP signaling. PMID: 21670213
  27. This study measures for the first time the activation entropy and enthalpy of ubiquitin-like modifications and finds that the E3 ligase, RanBP2, confers a large entropic effect to lower the activation energy, thereby accelerating the reactions. PMID: 21568279
  28. RanBP2 is a host factor that is involved in the nuclear import of HIV-1 PIC (DNA), but is not critical to the nuclear export of the viral mRNAs or nucleo-cytoplasmic shuttling of Rev PMID: 21179483
  29. Data establish a subset of RANBP2-type zinc fingers as a new family of ssRNA-binding motifs. PMID: 21256132
  30. Untreated recurrent acute necrotising encephalopathy associated with RANBP2 missense mutation, and normal outcome in a Caucasian boy. PMID: 20473521
  31. ANE may, in some instances, represent a familial disorder or may be the result of an inherited predisposition due to a mutation in the RANBP2 gene. It also broadens the phenotype of neurological problems in individuals that harbour a RANBP2 mutation. PMID: 19807769
  32. Both the patient and her mother, who had also had postviral polyneuritis in the past, harbour a mutation in Ran-binding protein 2 (RANBP2); this occurred de novo in the mother and confers genetic susceptibility to ANE. PMID: 19811512
  33. Oxidative stress up-regulated the binding of Crm1 to Ran and affected multiple repeat-containing nucleoporins by changing their localization, phosphorylation, O-glycosylation, or interaction with other transport components. PMID: 19828735
  34. Here, we define a Pro-Glu-Asp-Ser-Thr-rich element containing 129 amino acid residues, designated IR1+2, on the human nucleoporin RanBP2/Nup358, which binds directly to Ubc9 with high affinity both in vitro and in vivo PMID: 11709548
  35. The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase PMID: 12032081
  36. identification of RanBP2-mediated transport pathways with restricted neuronal and subcellular localization PMID: 12191015
  37. RanBP2 sumoylates MDM2 during nuclear translocation in human cells PMID: 12393906
  38. Without Nup358, chromosome congression and segregation are severely perturbed. Meanwhile, the assembly of other kinetochore components is strongly inhibited. PMID: 12963708
  39. RanGAP1 remains associated with RanBP2/Nup358 and the SUMO E2-conjugating enzyme Ubc9 in mitosis. PMID: 15037602
  40. Ubc9- small ubiquitin-like modifier (SUMO-1) thioester could be recruited to RanBP2 via SUMO-1 in the absence of strong binding between Ubc9 and RanBP2 PMID: 15608651
  41. Nup358/RanBP2 acts as an E3 by binding both SUMO and Ubc9 to position the SUMO-E2-thioester in an optimal orientation to enhance conjugation PMID: 15931224
  42. the intracellular levels of RanBP2 and its functional activity may be modulated by Parkin-mediated ubiquitination and proteasomal pathways PMID: 16332688
  43. The Trp2 allele is an age-dependent risk factor for the severity of disc degeneration in younger patients with symptomatic herniated nucleus pulposus of the lumbar spine. PMID: 16586133
  44. Our data imply that SUMO E3 proteins like RanBP2 facilitate spatio-temporal SUMOylation for certain nuclear structure and function. PMID: 16688858
  45. ent-15-oxokaurenoic acid inhibits mitotic chromosome movement and binds the kinetochore protein ran-binding protein 2 PMID: 17168522
  46. binding of the kinesin-binding domain of RanBP2 to KIF5B and KIF5C determines mitochondria localization and function PMID: 17887960
  47. Biopsy samples from 288 patients suffering from LDD with and without relapse were analyzed by PCR restriction fragment analysis and direct sequencing. The mutated Trp2 allele was not detected in the patients' samples of the present study. PMID: 18080148
  48. These data suggest a dual function of the Nup358-RanGAP1 complex as a coordinator of importin beta recycling and reformation of novel import complexes. PMID: 18305100
  49. Silencing of the RANBP2 E3 ligase reverts HDAC 4 repression by blocking its own sumoylation PMID: 18691615
  50. Data describe a mitotic SUMO2/3 conjugation-deconjugation cycle of Borealin and further assign a regulatory function of RanBP2 and SENP3 in the mitotic SUMO pathway. PMID: 18946085

Show More

Hide All

Involvement in disease
Encephalopathy, acute, infection-induced, 3 (IIAE3)
Subcellular Location
Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Nucleus envelope.
Protein Families
RanBP2 E3 ligase family
Database Links

HGNC: 9848

OMIM: 601181

KEGG: hsa:5903

STRING: 9606.ENSP00000283195

UniGene: Hs.199561

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*