Recombinant Human E3 SUMO-protein ligase RanBP2(RANBP2),partial

Code CSB-YP019311HU
Product Type Recombinant Protein
Size US$2474
Uniprot No. P49792
Relevance E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 358 kDa nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
Research Area others
Source Yeast
Gene Names RANBP2
Protein Names Recommended name: E3 SUMO-protein ligase RanBP2 EC= 6.3.2.- Alternative name(s): 358 kDa nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2 Short name= RanBP2 p270 Including t
Expression Region 2601-2802aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 24.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle
Involvement in disease Encephalopathy, acute, infection-induced, 3 (IIAE3)
Subcellular Location Nucleus, Nucleus membrane, Nucleus, nuclear pore complex, Nucleus envelope
Protein Families RanBP2 E3 ligase family
Database Links

HGNC: 9848

OMIM: 601181

KEGG: hsa:5903

STRING: 9606.ENSP00000283195

UniGene: Hs.199561

Related Products

RANBP2 Antibodies

RANBP2 Antibodies for Human

RANBP2 Antibodies for Homo sapiens (Human)

RANBP2 Proteins

RANBP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.