Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP019311HU |
| Product Type | Recombinant Protein |
| Size | US$2474 |
| Uniprot No. | P49792 |
| Relevance | E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | 358 kDa nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS |
| Research Area | others |
| Source | Yeast |
| Gene Names | RANBP2 |
| Protein Names | Recommended name: E3 SUMO-protein ligase RanBP2 EC= 6.3.2.- Alternative name(s): 358 kDa nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2 Short name= RanBP2 p270 Including t |
| Expression Region | 2601-2802aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 24.8kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle |
| Involvement in disease | Encephalopathy, acute, infection-induced, 3 (IIAE3) |
| Subcellular Location | Nucleus, Nucleus membrane, Nucleus, nuclear pore complex, Nucleus envelope |
| Protein Families | RanBP2 E3 ligase family |
| Database Links |
HGNC: 9848 OMIM: 601181 KEGG: hsa:5903 STRING: 9606.ENSP00000283195 UniGene: Hs.199561 |
RANBP2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019311LA01HU | RANBP2 Antibody | Human | ELISA, IHC |
RANBP2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019311LB01HU | RANBP2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA019311LC01HU | RANBP2 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA019311LD01HU | RANBP2 Antibody, Biotin conjugated | Human | ELISA |
RANBP2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP019311HU | Recombinant Human E3 SUMO-protein ligase RanBP2(RANBP2),partial | E.coli |
| CSB-BP019311HU CSB-MP019311HU |
Recombinant Human E3 SUMO-protein ligase RanBP2(RANBP2) ,partial | Baculovirus Mammalian cell |
Recombinant Human Putative inactive neutral ceramidase B(ASAH2B)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Ral-B(RALB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein phosphatase 1A(PPM1A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase A3(PDIA3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Rab-10(RAB10),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein R-Ras2(RRAS2)
Express system: E.coli
Species: Homo sapiens (Human)
