Recombinant Human EF-hand domain-containing protein D2 (EFHD2)

In Stock
Code CSB-EP856907HU
Abbreviation Recombinant Human EFHD2 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
EFHD2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Swiprosin-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-240aa
Target Protein Sequence
ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance.
Gene References into Functions
  1. Data demonstrate that EFhd2 shows unique structural and biological features as an EF-hand containing F-actin bundling protein. For F-actin bundling activity, structural stabilization of the EF-hand domains was found to occur in the presence of Ca2+. The core region of EFhd2 maintains its structure in the absence of Ca2+ ; however, changes in local conformational flexibility reduce F-actin bundling activity of EFhd2. PMID: 27974828
  2. Phosphorylation at Ser183 of EFhd2 causes changes in the local conformational dynamics and the surface charge distribution of the actin-binding site, resulting in a re-coordination of the actin-binding sites in the dimer structure. PMID: 28011271
  3. The results imply that EFhd2's physiological and/or pathological function could be regulated by its phosphorylation state. PMID: 24917152
  4. EFhd2 is involved in the control of synapse development and maintenance and is linked to dementia. PMID: 25383639
  5. Swiprosin-1 localizes to microvilli-like membrane protrusions and lamellipodia and exhibits actin-binding activity. PMID: 23977092
  6. Swiprosin-1 is involved in regulating the accessibility of F-actin to cofilin through the clustering of F-actin and the activity of Swiprosin-1 is highly dependent on its phosphorylation status at Ser183 PMID: 23959172
  7. EFhd2 may play an important role in the pathobiology of tau-mediated neurodegeneration. PMID: 23331044
  8. the human Shu complex (hSWS1.SWSAP1) has an evolutionarily conserved function in homologous recombination PMID: 21965664
  9. This protein has been found differentially expressed in thalami from patients with schizophrenia. PMID: 20471030
  10. Its predominant presence in CD8 lymphocytes suggests that swiprosin-1 may be involved in functions that are important for cytotoxic lymphocytes. PMID: 15274114
  11. These results suggest that swiprosin-1 is a PKC-beta I/eta-inducible gene and it modulates mast cell activation through NF-kappaB-dependent pathway. PMID: 19693767

Show More

Hide All

Subcellular Location
Membrane raft.
Tissue Specificity
Found in lymphocytes; preferentially expressed in CD8+ cells.
Database Links

HGNC: 28670

OMIM: 616450

KEGG: hsa:79180

STRING: 9606.ENSP00000365147

UniGene: Hs.465374

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*