Recombinant Human ETS translocation variant 5 (ETV5), partial

Code CSB-EP007859HU
Abbreviation Recombinant Human ETV5 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ETV5
Uniprot No.
Research Area
Cancer
Alternative Names
Ets-related protein ERM
Source
E.coli
Expression Region
124-265aa
Target Protein Sequence
DRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to DNA sequences containing the consensus nucleotide core sequence 5'-GGAA.-3'.
Gene References into Functions
  1. exploration of the underlying mechanism demonstrated that ICAM3 not only binds to LFA-1 with its extracellular domain and structure protein ERM but also to lamellipodia with its intracellular domain which causes a tension that pulls cells apart (metastasis). PMID: 29729315
  2. High Etv5 expression is associated with glioma. PMID: 29787563
  3. Novel ETV5 SNP rs7647305 is associated with childhood hypertension adjusted by obesity. PMID: 28645872
  4. MiR-200b inhibition by transfection in MCF-7 markedly decreased miR-200b level, elevated ERM expression, and enhanced cell migration and invasion. MiR-200b overexpression in MDA-MB-231 obviously increased miR-200b level, reduced ERM expression, and weakened cell migration and invasion. PMID: 27276064
  5. Resistin, a fat-derived secretory factor, promotes metastasis of MDA-MB-231 human breast cancer cells through ERM activation PMID: 26729407
  6. ERM proteins contribute toward accelerated CD44 shedding by MT1-MMP through ERM protein-mediated interactions between their cytoplasmic tails. PMID: 26289026
  7. Our results reveal a novel ERM-based spatial mechanism that is coopted by DLBCL cells to sustain tumor cell growth and survival. PMID: 25801911
  8. Increase of ETV5 protein expression is associated with endometrial cancer invasion. PMID: 25924802
  9. Snail regulates the motility and invasiveness of oral cancer cells via RhoA/Cdc42/p-ERM pathway. PMID: 25172658
  10. there is a higher expression of ERM/ETV5 in early stages of endometrioid endometrial carcinomas PMID: 24756106
  11. we found that the downregulation of ETV5 reduced the expression of the oncogenic transcription factor FOXM1. PMID: 22589409
  12. This data suggests that ETV5 has a significant role in regulating MMP2 expression and therefore matrix resorption in human chondrosarcoma, and thus may be a targetable upstream effector of the metastatic cascade in this cancer. PMID: 22968857
  13. we propose ETV5-transcriptional regulation of the EMT process through a crosstalk with the tumor surrounding microenvironment, as a principal event initiating EC invasion. PMID: 22266854
  14. The homozygous +48845 G>T (TT allele) variant confers a higher risk for male infertility associated with nonobstructive azoospermia and Sertoli cell only syndrome in Australian men. PMID: 22771031
  15. Upregulation of ETV5 induced the expression of cell adhesion molecules and enhanced cell survival in a spheroid model. PMID: 21520040
  16. results indicate concurrent mechanisms in expression of MMP-2 and -9, RUNX1/AML1 and ETV5/ERM, and several basement membrane components, which likely associate with the invasive stage of endometrioid endometrial and ovarian endometrioid carcinoma. PMID: 20970160
  17. The flexible nature of transactivation domain may be instrumental for ERM recognition and binding to diverse molecular partners. PMID: 20647002
  18. functional role for the ERMs (ezrin/radixin/moesin) as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases PMID: 12387735
  19. ERM has a role in progression of breast cancer PMID: 15534105
  20. The erm gene expression is regulated by the conventional PKC (cPKC) pathway. PMID: 15620692
  21. CD44-mediated hyaluronan binding in myeloid cells is regulated by phosphorylated ERM and the actin cytoskeleton. PMID: 15652352
  22. ERM is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity PMID: 15857832
  23. Erm is involved in SP-C regulation, which results from an interaction with TTF-1 PMID: 16613858
  24. analysis of NHERF recognition by ERM proteins PMID: 16615918
  25. Testing various shorter fragments of ERM as bait indicated that the region essential for binding CHD3/ZFH is within the amino acid region 96-349, which contains the central inhibitory DNA-binding domain (CIDD) of ERM PMID: 17489097
  26. ERM/ETV5 up-regulation activates MMP-2 and thus has a role during myometrial infiltration in endometrial cancer PMID: 17638886
  27. A TMPRSS2:ETV5 gene fusion was identified in prostate cancer. PMID: 18172298

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
ETS family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 3494

OMIM: 601600

KEGG: hsa:2119

STRING: 9606.ENSP00000306894

UniGene: Hs.43697

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*