Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ENAM

Uniprot No.

Q9NRM1

Research Area

Others

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1043-1142aa

Target Protein Sequence

ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

12.4 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Involved in the mineralization and structural organization of enamel. Involved in the extension of enamel during the secretory stage of dental enamel formation.

Gene References into Functions

Lack of association between the ENAM polymorphism (rs12640848) and dental caries in Czech children was detected. PMID: 29185146
The ENAM and TNF-alpha genes were likely associated with caries occurrence in Chinese children. The ENAM rs3796703 CT and TNF-alpha rs1800629 AG genotypes might be involved in caries susceptibility and protection, respectively. PMID: 28395167
study investigated the phenotypic effect of SNP C14625T (rs7671281) on the thickness of human dental enamel, exploring the effects of positive selection on a dental gene PMID: 27357321
Among the variants shared with modern humans, two are ancestral (common with apes) and one is the derived enamelin major variant, T648I (rs7671281), associated with a thinner enamel and specific to the Homo lineage. PMID: 28902892
The study revealed the strong association between rs12640848 marker of ENAM gene and caries susceptibility in primary teeth in children from Poland. PMID: 26910531
Overrepresentation of the G allele of the enamelin marker was seen in the erosion group compared to the unaffected group. PMID: 25791822
Screening of ENAM and LAMB3 genes was performed by direct sequencing of genomic DNA from blood samples. PMID: 25769099
findings provide useful information for the implication of ENAM gene polymorphism in autosomal-dominant/-recessive amelogenesis imperfecta. PMID: 25427323
Whole-exome sequencing identified 2 novel heterozygous nonsense mutations in the ENAM gene (c.454G>T p.Glu152* in family 1, c.358C>T p.Gln120* in family 2) in the probands. Affected individuals were heterozygous for the mutation in each family. PMID: 25143514
2 exonic SNPs, both changing an amino acid in protein region encoded by exon 10 (p.I648T and p.R763Q), increased caries susceptibility 2.66-fold. findings support ENAM as gene candidate for caries susceptibility. PMID: 24487377
Associations between TFIP11 (p=0.02), ENAM (p=0.00001), and AMELX (p=0.01) could be seen with caries independent of having MIH or genomic DNA copies of Streptococcus mutans detected by real time PCR in the Brazilian sample. PMID: 23790503
Mutations in FAM83H and ENAM and related phenotypes were observed in Chinese families with amelogenesis imperfecta. PMID: 22414746
hypocalcified amelogenesis imperfecta, Witkop type III, was unrelated to previously described mutations in the ENAM or MMP-20 genes PMID: 21504268
The structure and composition of deciduous enamel affected by local hypoplastic autosomal dominant amelogenesis imperfecta resulting from an ENAM mutation PMID: 19923784
A nonsense mutation in the enamelin gene causes local hypoplastic autosomal dominant amelogenesis imperfecta PMID: 11978766
heterogeneous mutations are responsible for an autosomal-dominant hypoplastic form of amelogenesis imperfecta PMID: 12407086
critical for proper dental enamel formation PMID: 14656895
Demonstration of a ENAM mutation responsible for autosomal recessive amelogenesis imperfecta and localised enamel pitting. PMID: 14684688
Ultrastructural enamel changes in the patient with the autosomal dominant ENAM g.13185-13186insAG mutation, were less pronounced compared to ultrastructural changes in patients with the autosomal dominant ENAM mutation 8344delG. PMID: 17125728
A mutation was found in exon 9 where guanine was substituted by thymine in one of the alleles in position 817, generating a change of arginine to methionine in codon 179 of the protein. PMID: 17316551
This work shows that bursts of adaptive enamelin evolution occur on primate lineages with inferred dietary changes. PMID: 18245370
a single base difference g359A --> G located in exon 1 was identified and ruled out the possible mutation in exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, exon 9, exon 10, g2382, g6395 and g8344 of ENAM gene in the AI patient. PMID: 18466877
A total of 463 individuals from 54 families were evaluated and mutations in the AMEL, ENAM and KLK4 genes were identified. PMID: 18714142
Analysis revealed 2 ENAM mutations (autosomal-dominant g.14917delT and autosomal-recessive g.13185-13186insAG mutations). Single T deletion in exon 10 is a novel deletion mutation(g.14917delT, c.2991delT)predicted to result in premature termination codon. PMID: 19329462

Hide All

Involvement in disease

Amelogenesis imperfecta 1B (AI1B); Amelogenesis imperfecta 1C (AI1C)

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Tissue Specificity

Expressed in tooth particularly in odontoblast, ameloblast and cementoblast.

Database Links

HGNC: 3344

OMIM: 104500

KEGG: hsa:10117

STRING: 9606.ENSP00000379383

UniGene: Hs.667018

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-BP007662HU
MSDS	MSDS
Size	$472
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Enamelin (ENAM), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage