Recombinant Human Endogenous retrovirus group K member 113 Pro protein (HERVK_113)

In Stock
Code CSB-EP351212HU
Abbreviation Recombinant Human HERVK_113 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HERVK_113
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-156aa
Target Protein Sequence
WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKIPVEAKINQKREGIGYPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Endogenous retrovirus group K member 113 Pro protein (HERVK_113) is produced in an E. coli expression system, covering the protein's complete 1-156 amino acid sequence. The protein carries a C-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms that purity levels exceed 95%. This protein is strictly for research purposes.

HERVK_113 appears to be linked with human endogenous retrovirus group K. These retroviral elements likely represent traces of ancient infections that became integrated into our genome over evolutionary time. Studying HERVK_113 may be important for understanding how retroviruses evolved and what roles they might play in human biology and disease. Scientists often examine these proteins to see how they might influence gene expression or affect human health, though the connections aren't always clear.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human Endogenous Retrovirus Group K Member 113 Pro protein is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic viral proteins. This retroviral protein likely requires specific folding, post-translational modifications, and potentially protease activity for its biological function. While the protein is full-length (1-156aa) with a C-terminal 6xHis tag and high purity (>95%), E. coli lacks the eukaryotic chaperones and modification machinery necessary for proper folding of complex viral proteins. The C-terminal His-tag may interfere with the native protein structure. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation.

1. Antibody Development and Validation Studies

The recombinant protein can serve as an effective immunogen for generating antibodies that recognize linear epitopes, even if the protein is misfolded. The high purity and C-terminal His-tag facilitate purification and screening. However, antibodies may not recognize conformational or modification-dependent epitopes of native, properly folded retroviral protein in human cells.

2. Protein-Protein Interaction Studies

This application is high-risk without folding validation. While the His-tag enables technical feasibility for pull-down assays, if the protein is misfolded (as likely in E. coli), it will not interact physiologically with true cellular binding partners. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding.

3. Biochemical Characterization and Stability Studies

This application is well-suited for assessing the recombinant human Endogenous Retrovirus Group K Member 113 Pro protein itself. Techniques like circular dichroism spectroscopy, size-exclusion chromatography, and thermal shift assays can evaluate the protein's folding state and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant product.

4. His-Tag-Based Affinity Purification Method Development

This application is appropriate for technical optimization. The protein can be used to develop and refine purification protocols for His-tagged proteins. However, methods developed using this potentially misfolded protein may not directly apply to properly folded viral proteins.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this complex retroviral protein, recommend first performing comprehensive biophysical characterization to assess folding quality. This should include circular dichroism spectroscopy for secondary structure analysis and size-exclusion chromatography with multi-angle light scattering for oligomeric state assessment. Antibody development can proceed immediately as the safest application. Avoid all functional studies (interactions) until proper folding is validated. For reliable retroviral protein studies, obtain the protein from mammalian expression systems capable of proper folding and post-translational modifications. Always include appropriate controls and validate findings with native protein when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Retroviral proteases have roles in the processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution.
Protein Families
Peptidase A2 family, HERV class-II K(HML-2) subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*