Recombinant Human Epithelial sodium channel subunit alpha (SCNN1A), partial

Code CSB-MP020848HUd7
Abbreviation Recombinant Human SCNN1A protein, partial
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SCNN1A
Uniprot No.
Research Area
Cancer
Alternative Names
Alpha-NaCH;Amiloride-sensitive sodium channel subunit alpha;Nonvoltage-gated sodium channel 1 subunit alpha;SCNEA;Sodium channel epithelial 1 subunit alpha
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
107-562aa
Target Protein Sequence
GEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and eccrine sweat glands. Also plays a role in taste perception.
Gene References into Functions
  1. In the present study, the SCNN1G gene was associated with 24-h urinary sodium excretion but was not related to blood pressure. The SCNN1A and SCNN1B genes were not associated with blood pressure either. PMID: 29757959
  2. mutation in the extracellular domain of alphaENaC causes Liddle syndrome by increasing intrinsic channel activity. PMID: 28710092
  3. The mRNA and alpha-ENaC protein were overexpressed in platelets from hypertensive subjects versus control subjects. PMID: 27137675
  4. The derlin-1 pathway therefore may represent a significant early checkpoint in the recognition and degradation of ENaC in mammalian cells. PMID: 28137758
  5. Data show that the expression of aquaporin (AQP) 1, AQP3, AQP5, epithelial Na+ channel (ENaC) and sodium potassium ATPase (Na-K-ATPase) are altered in patients with acute respiratory failure (ARF) due to diffuse alveolar damage (DAD), and the cause of DAD does not seem to influence the level of impairment of these channels. PMID: 27835672
  6. The data indicate that the Lhs1 chaperone selectively recognizes an immature form of alphaENaC, one which has failed to correctly assemble with the other channel subunits via its transmembrane domain. PMID: 27903760
  7. LEFTY2 regulates the expression and activity of ENaC in endometrial epithelial cells via SGK1. PMID: 27606670
  8. Carriage of the p.W493R-SCNN1A polymorphism has been identified as a risk factor for bronchiectasis, but it is not invariably associated with the phenotype of a hyperactive ENaC channel in the lung. PMID: 26453628
  9. although subgroup analysis showed alpha-ENaC T663A polymorphism was associated with essential hypertension in North American individuals, these meta-analysis results did not confirm such association overall; conclude that Alpha-ENaC T663A polymorphism might not be a risk factor for essential hypertension PMID: 26318459
  10. Neither bronchodilatory response nor bicycling time trial performance after salbutamol was affected by genotype at rs2228576. PMID: 25894531
  11. Four nonsynonymous amino acid variants in SCNN1A in nonwhite Cystic fibrosis patients with non-diagnostic CFTR genotypes was identified. PMID: 25900089
  12. The rs4149570 and rs7956915 polymorphisms of SCNN1A might play important roles in the susceptibility to respiratory distress syndrome, particularly in term infants. PMID: 26611714
  13. These results indicate that ENaC functions as a sensor for external Cd2+. PMID: 27045669
  14. The transcriptional expression of alpha, beta, and gamma subunits of ENaC was elevated in nasal polyp compared to nasal mucosa PMID: 25559464
  15. The long isoform of alphaENaC forms the structural basis of a channel with different activity and regulation, which may not be easily distinguishable in native tissue, but may underlie sodium hyperabsorption and salt sensitive differences in humans. PMID: 25517724
  16. ENaC regulates miR-101/miR-199a-3p during embryo implantation with the involvement of CREB phosphorylation. PMID: 25187622
  17. Five de novo mutations were identified in four genes (SCNN1A, KCNJ16, KCNB2, and KCNT1) in three Brugada syndrome patients PMID: 25339316
  18. ASIC1A and ENaCalpha form functional heterotrimers acting as ion channels. PMID: 26032502
  19. SCNN1A and SCNN1G SNPs may contribute to blood pressure changes over time in the Han Chinese population. PMID: 24735600
  20. Skin hydration status regulates sodium homeostasis and inflammatory pathways through the epithelial sodium channel (ENaC). PMID: 25371970
  21. It essentially participates in regulatory systems of blood pressure and normal gas exchange. PMID: 25242083
  22. Increased CFTR expression and decreased ENaC-alpha expression in the decidua of early abortion may relate with failure of early pregnancy. PMID: 24914548
  23. Cystic fibrosis-like disease probably has an oligogenic origin, resulting from mutations in several genes, including CFTR, SERPINA1, and SCNN1 isoforms. PMID: 23837941
  24. In this study, authors found that miR-125b inhibits hepatitis B virus expression in vitro by regulating SCNN1A expression. PMID: 25173609
  25. dexamethasone increases the transcript and protein expression of the alpha-, beta-, and gamma-ENaC subunits via the GR-SGK1-Nedd4-2 pathway and provides insight into the molecular mechanism of the increased sodium transport mediated by ENaC PMID: 24114932
  26. Two novel mutations in the SCNN1A gene causing pseudohypoaldosteronism type 1 have been identified in two unrelated Chinese infants. PMID: 23762408
  27. ENaC hyperactivity in cystic fibrosis airways is a direct consequence of acidic airway-surface-liquid (ASL) dehydration which can be reversed by raising ASL pH. PMID: 24043776
  28. found a diminished expression of the three subunits of the ENaC in the membranes of preeclamptic placentas in comparison with the normal ones PMID: 23218889
  29. WNK4 inhibits ENaC channel activity independently of Nedd4-2-mediated ENaC ubiquitination. PMID: 23594824
  30. Data indicate that Grp170 (Lhs1 ortholog) coprecipitate with alphaENaC. PMID: 23645669
  31. Data indicate that pharmacological KvLQT1 and KATP (Kir6.1) inhibition or silencing with siRNAs down-regulated alpha-ENaC expression. PMID: 22406554
  32. ENaC in the vascular endothelium determines cellular mechanics and hence might participate in the control of vascular function. PMID: 23460285
  33. None of the NO-donors had a significant effect on the expression of the ENaC subunits in the presence and absence of L-cysteine in cystic fibrosis airway epithelial cells. PMID: 23523754
  34. The alpha subunit is essential for ENaC function and mutations truncating the pore-forming part of the protein leading to systemic pseudohypoaldosteronism type 1 PMID: 23416952
  35. enetic variation of SCNN1A differentially affects the diffusing capacity in patients with Cystic fibrosis. PMID: 22776878
  36. Ubiquitin-specific peptidase 8 (USP8) regulates endosomal trafficking of the epithelial Na+ channel PMID: 23297398
  37. Data suggest that proteolytic activation of ENaC by plasmin may contribute to Na(+) retention and hypertension in preeclampsia. PMID: 22987920
  38. study found that rhinovirus (RV) infection of primary human nasal epithelial cells enhanced the expression of CFTR, alpha-ENaC, beta-ENaC, and gamma-ENaC mRNA and protein; upregulated CFTR might be dysfunctional, whereas RV-upregulated ENaC was hyperfunctional PMID: 22374202
  39. findings suggest that a helical conformation in its carboxyterminal part is functionally important to mediate ENaC inhibition by the alpha-13-mer peptide PMID: 22613977
  40. G2139A, G3091A, T663A, and T3593C polymorphisms of alphaENaC gene may play an important role in the development of essential hypertension among Kazakhs in Xinjiang. PMID: 20078945
  41. investigation of control of airway epithelial Na+ absorption via up-regulation/phosphorylation of ENaCalpha, ENaCbeta, and ENaCgamma involving SGK1 (serum-glucocorticoid regulated kinase 1) under control of glucocorticoid/dexamethasone PMID: 22250980
  42. Multiple residues in the distal C terminus of the alpha-subunit have roles in modulating human epithelial sodium channel activity. PMID: 22573385
  43. These results indicate a previously undefined role of ENaC in regulating the PGE production and release required for embryo implantation. PMID: 22729284
  44. Genotype-phenotype correlations and new clinical and genetic entities that may prove relevant for patient's care in neonates with renal salt losing syndromes and/or failure to thrive. PMID: 21664233
  45. Functional overexpression of voltage-sensitive sodium channel beta-subunits in prostate cancer may be one type of mechanism leading to increased metastatic behavior while decreasing the ability to form localized tumor masses. PMID: 22127840
  46. A hyperactive variant p.W493R-SCNN1A of the epithelial sodium channel does not necessarily cause CF-like disease in a CF gene carrier, but its low frequency in CF parents suggests that it is a risk factor. PMID: 21917531
  47. ENaC on motile cilia should be essential for diverse functions of motile cilia, such as germ cell transport, fertilization, implantation, clearance of respiratory airways and cell migration. PMID: 22207244
  48. genetic variation of the alpha-subunit of ENaC at amino acid 663 influences lung diffusion at peak exercise in healthy humans PMID: 21893217
  49. genetic variation of ENaC influences beta(2)-adrenergic receptor stimulated Na(+) clearance in the lungs. PMID: 21889619
  50. large dietary sodium intervention study indicates that common variants of ENaC subunits A,B,G may contribute to the variation of BP response to dietary sodium intake PMID: 21562341

Show More

Hide All

Involvement in disease
Pseudohypoaldosteronism 1, autosomal recessive (PHA1B); Bronchiectasis with or without elevated sweat chloride 2 (BESC2)
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell projection, cilium. Cytoplasmic granule. Cytoplasm. Cytoplasmic vesicle, secretory vesicle, acrosome. Cell projection, cilium, flagellum.
Protein Families
Amiloride-sensitive sodium channel (TC 1.A.6) family, SCNN1A subfamily
Tissue Specificity
Expressed in the female reproductive tract, from the fimbrial end of the fallopian tube to the endometrium (at protein level). Expressed in kidney (at protein level). In the respiratory tract, expressed in the bronchial epithelium (at protein level). High
Database Links

HGNC: 10599

OMIM: 264350

KEGG: hsa:6337

STRING: 9606.ENSP00000353292

UniGene: Hs.591047

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*