Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
17 beta HSD 11; 17 beta HSD XI; 17 BETA HSD11; 17 BETA HSDXI ; 17 beta hydroxysteroid dehydrogenase 11; 17 beta hydroxysteroid dehydrogenase type XI; 17 beta hydroxysteroid dehydrogenase XI; 17-beta-HSD 11; 17-beta-HSD XI; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase XI; 17betaHSD11; 17betaHSDXI; 17bHSD11; CTCL associated antigen HD CL 03; CTCL tumor antigen HD CL 03 ; CTCL-associated antigen HD-CL-03; Cutaneous T cell lymphoma associated antigen HD CL 03; Cutaneous T-cell lymphoma-associated antigen HD-CL-03; Dehydrogenase/reductase SDR family member 8; DHB11_HUMAN; DHRS8; Estradiol 17 beta dehydrogenase 11; Estradiol 17-beta-dehydrogenase 11; Hsd17b11; Hydroxysteroid (17 beta) dehydrogenase 11; PAN1B; Retinal short chain dehydrogenase/reductase 2; Retinal short-chain dehydrogenase/reductase 2; RETSDR2; SDR16C2; SDR2; Short chain dehydrogenase/reductase family 16C member 2; T cell lymphoma associated antigen HD CL 03
Species
Homo sapiens (Human)
Expression Region
20-300aa
Target Protein Sequence
ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human HSD17B11 was expressed with the amino acid range of 20-300. The theoretical molecular weight of the HSD17B11 protein is 46.8 kDa. Expression of this HSD17B11 protein is conducted in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of HSD17B11, making it easier to detect and purify the HSD17B11 recombinant protein in the later stages of expression and purification.
Human Estradiol 17-beta-dehydrogenase 11 (HSD17B11) is an enzyme involved in the conversion of estrone to estradiol, a key step in estrogen biosynthesis. HSD17B11's main role in steroid hormone metabolism positions it as a significant player in endocrine regulation. In medical and reproductive research, studying HSD17B11 provides insights into hormone-related conditions and potential therapeutic targets for estrogen-dependent diseases. Its involvement in cancer progression implicates HSD17B11 in oncology research, offering avenues for targeted therapies. Investigating HSD17B11 spans endocrinology, reproductive medicine, and oncology, contributing to a comprehensive understanding of hormone dynamics and presenting opportunities for developing therapeutic strategies for hormone-related disorders and cancers.
