Recombinant Human Estradiol 17-beta-dehydrogenase 11 (HSD17B11)

In Stock
Code CSB-EP843318HU
Abbreviation Recombinant Human HSD17B11 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HSD17B11
Uniprot No.
Research Area
Metabolism
Alternative Names
17 beta HSD 11; 17 beta HSD XI; 17 BETA HSD11; 17 BETA HSDXI ; 17 beta hydroxysteroid dehydrogenase 11; 17 beta hydroxysteroid dehydrogenase type XI; 17 beta hydroxysteroid dehydrogenase XI; 17-beta-HSD 11; 17-beta-HSD XI; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase XI; 17betaHSD11; 17betaHSDXI; 17bHSD11; CTCL associated antigen HD CL 03; CTCL tumor antigen HD CL 03 ; CTCL-associated antigen HD-CL-03; Cutaneous T cell lymphoma associated antigen HD CL 03; Cutaneous T-cell lymphoma-associated antigen HD-CL-03; Dehydrogenase/reductase SDR family member 8; DHB11_HUMAN; DHRS8; Estradiol 17 beta dehydrogenase 11; Estradiol 17-beta-dehydrogenase 11; Hsd17b11; Hydroxysteroid (17 beta) dehydrogenase 11; PAN1B; Retinal short chain dehydrogenase/reductase 2; Retinal short-chain dehydrogenase/reductase 2; RETSDR2; SDR16C2; SDR2; Short chain dehydrogenase/reductase family 16C member 2; T cell lymphoma associated antigen HD CL 03
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-300aa
Target Protein Sequence
ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human HSD17B11 was expressed with the amino acid range of 20-300. The theoretical molecular weight of the HSD17B11 protein is 46.8 kDa. Expression of this HSD17B11 protein is conducted in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of HSD17B11, making it easier to detect and purify the HSD17B11 recombinant protein in the later stages of expression and purification.

Human Estradiol 17-beta-dehydrogenase 11 (HSD17B11) is an enzyme involved in the conversion of estrone to estradiol, a key step in estrogen biosynthesis. HSD17B11's main role in steroid hormone metabolism positions it as a significant player in endocrine regulation. In medical and reproductive research, studying HSD17B11 provides insights into hormone-related conditions and potential therapeutic targets for estrogen-dependent diseases. Its involvement in cancer progression implicates HSD17B11 in oncology research, offering avenues for targeted therapies. Investigating HSD17B11 spans endocrinology, reproductive medicine, and oncology, contributing to a comprehensive understanding of hormone dynamics and presenting opportunities for developing therapeutic strategies for hormone-related disorders and cancers.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma.
Gene References into Functions
  1. knowledge of its in vitro activity together with a newly described expression pattern at the protein level in tissues involved in steroidogenesis and detoxification could suggest a potential role of DHRS8 in vivo PMID: 26472732
  2. hydroxysteroid (17-beta) dehydrogenase 11 transcription in prostate cancer cells is regulated by Sp1 transcription factor and C-EBP alpha PMID: 21549806
  3. Role for 17-beta-HSDXI in androgen metabolism during steroidogenesis. PMID: 12697717
  4. Mutation analyses suggest that the PAT-like motif in 17betaHSD11 will not be functionally similar to the canonical PAT motif. PMID: 18804447
  5. Increased Pan1b is associated with prostate cancer of seminal vesicle invasion. PMID: 19469652

Show More

Hide All

Subcellular Location
Endoplasmic reticulum. Lipid droplet.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Tissue Specificity
Present at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini of adult trachea, in
Database Links

HGNC: 22960

OMIM: 612831

KEGG: hsa:51170

STRING: 9606.ENSP00000351035

UniGene: Hs.594923

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*