Recombinant Human Eukaryotic translation elongation factor 1 epsilon-1 (EEF1E1)

Code CSB-EP007432HU
Abbreviation Recombinant Human EEF1E1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
EEF1E1
Uniprot No.
Research Area
Metabolism
Alternative Names
AIMP 3; AIMP3; Aminoacyl tRNA synthetase complex interacting multifunctional protein 3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS interacting multifunctional protein 3; EEF1E1; Elongation factor p18; Eukaryotic translation elongation factor 1 epsilon 1; Eukaryotic translation elongation factor 1 epsilon-1; Homolog of rat elongation factor p18; MCA3_HUMAN; Multisynthase complex auxiliary component p18; Multisynthetase complex auxiliary component p18; p18; p18 component of aminoacyl tRNA synthetase complex
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-174aa
Target Protein Sequence
AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Positive modulator of ATM response to DNA damage.
Gene References into Functions
  1. LmnA binds AIMP3 via its extreme C-terminus. Together these findings provide a structural insight for understanding the interaction between AIMP3 and LmnA in AIMP3 degradation. PMID: 28797100
  2. AIMP3 was shown to be involved in the cellular aging of human mesenchymal stem cells. PMID: 25465621
  3. Identification of EEf1E1 and OBFC2B as novel BRCA1-partner genes in the DNA double-strand break repair pathway. PMID: 24104880
  4. AIMP3 stabilizes and protects methionyl-tRNA synthetase and eIF2gamma through the binding interactions. PMID: 23306449
  5. AIMP3 is a critical mediator of Met-tRNA(i)(Met) transfer from methionyl-tRNA synthetase to eIF2 complex for the accurate and efficient translation initiation PMID: 22867704
  6. Data show that aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3)/p18 is released from aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3) by UV irradiation-induced stress. PMID: 22106287
  7. Decreased expression of AIMP3 in gastric and colorectal cancer tissues suggests that down-regulation of this protein may be related to inactivation of the tumor suppressor functions of AIMP proteins and might play a role in the development of GC and CRC. PMID: 21789020
  8. p18 is a haploinsufficient tumor suppressor and a key factor for ATM/ATR-mediated p53 activation. PMID: 15680327
  9. analysis of the three-dimensional structure and residues of the novel tumor suppressor AIMP3/p18 required for the interaction with PMID: 18343821
  10. No EEF1E1 mutations were detected in human cancer specimens. PMID: 19024604

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytosol. Nucleus. Note=Cytoplasmic under growth arrest conditions. Translocated into the nucleus when growth resumes (S phase) and following DNA damage.
Tissue Specificity
Down-regulated in various cancer tissues.
Database Links

HGNC: 3212

OMIM: 609206

KEGG: hsa:9521

STRING: 9606.ENSP00000369038

UniGene: Hs.602353

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*