Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial

In Stock
Code CSB-EP021434HU
Abbreviation Recombinant Human SLC1A3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Sodium-dependent glutamate/aspartate transporter 1;GLAST-1;Solute carrier family 1 member 3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
146-236aa
Target Protein Sequence
HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Excitatory amino acid transporter 1 (SLC1A3) is produced using an E.coli expression system, with researchers focusing specifically on amino acids 146-236 of the protein. This partial protein comes with an N-terminal 6xHis-KSI tag, which appears to make purification and detection more straightforward. SDS-PAGE analysis confirms the product achieves greater than 85% purity, though this may vary between batches.

The Excitatory amino acid transporter 1 (EAAT1), which the SLC1A3 gene encodes, seems to play a critical role in moving glutamate across cell membranes. Its primary function likely involves maintaining neurotransmitter balance in the central nervous system by removing glutamate from synaptic spaces. This makes EAAT1 particularly relevant for scientists studying synaptic transmission and neural health.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human SLC1A3 fragment is expressed in E. coli, a prokaryotic system that is fundamentally unsuitable for producing functional eukaryotic membrane transport proteins. SLC1A3 is a complex transmembrane protein with multiple membrane-spanning domains that require precise folding, proper membrane insertion, and specific oligomerization for function. The expressed fragment (146-236aa) represents only a small portion of the full-length protein and is fused to a large N-terminal 6xHis-KSI tag, which likely interferes with proper folding. E. coli lacks the eukaryotic chaperones and membrane environment necessary for the correct folding of neurotransmitter transporter domains. Since activity is unverified and the expression system is mismatched for this complex membrane protein, the protein is highly likely to be misfolded and inactive without experimental validation.

1. Antibody Development and Validation

This application is appropriate as the safest use case. The recombinant SLC1A3 fragment can serve as an immunogen for generating antibodies that recognize linear epitopes within the 146-236aa region, even if the protein is misfolded. The His-KSI tag facilitates purification and screening. However, antibodies may not recognize conformational or membrane-embedded epitopes of the full-length, properly folded SLC1A3 transporter in its native cellular context. Validation against native SLC1A3 from mammalian membranes is essential.

2. Protein-Protein Interaction Studies

This application is high-risk without folding validation. While the His-tag enables technical feasibility for pull-down assays, if the SLC1A3 fragment is misfolded (as expected in E. coli), it will not present physiological interaction interfaces. The 146-236aa region may contain partial domains that require a specific membrane context for proper folding. Identified interactions are likely to be non-physiological artifacts. This application requires prior confirmation of proper folding.

3. Epitope Mapping and Binding Studies

This application is feasible for linear epitope mapping but problematic for conformational studies. The defined fragment can help map antibody recognition to the 146-236aa region. However, if the protein is misfolded, surface plasmon resonance or binding studies will not reflect native protein-ligand interactions. This application should be limited to linear epitope characterization unless proper folding is demonstrated.

4. Biochemical Characterization and Stability Studies

This application is well-suited for assessing the recombinant product itself. Techniques like circular dichroism spectroscopy and thermal stability assays can evaluate the fragment's structural properties. However, results will characterize the E. coli-expressed product and may not reflect the behavior of this region within the full-length, membrane-embedded native protein.

Final Recommendation & Action Plan

Given the high probability of misfolding due to E. coli expression and the presence of a large fusion tag, recommend first performing biophysical characterization (circular dichroism for secondary structure analysis, size-exclusion chromatography for oligomeric state) to assess folding quality. Antibody development and linear epitope mapping can proceed as the lowest-risk applications. Avoid all protein interaction studies and conformational binding assays until proper folding is validated. For reliable SLC1A3 functional studies, obtain full-length protein expressed in mammalian or insect cell systems capable of proper membrane insertion and folding. Always include appropriate controls and validate findings with native SLC1A3 when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion. Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport. Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate.
Gene References into Functions
  1. EAAT1 rs2731880 SNP is associated with amygdala functional connectivity in bipolar disorder. PMID: 30073554
  2. Episodic ataxias 6 is caused by heterozygous mutations in SLC1A3, which encodes a subunit of a glial excitatory amino acid transporter, EAAT1. PMID: 29891059
  3. a novel missense mutation, c.383T>G (p.Met128Arg) in SLC1A3, in an episodic ataxia patient by whole-exome sequencing. PMID: 29208948
  4. This is the first study to link SLC1A3 and EPHB2 to clinically relevant vertebral osteoporosis phenotypes. PMID: 27476799
  5. crystal structures of a thermostabilized human SLC1 transporter, the excitatory amino acid transporter 1 (EAAT1), with and without allosteric and competitive inhibitors bound PMID: 28424515
  6. This study demonstrated that the cytopathology and episodic paralysis in our Drosophila EA6 model stem from a gain-of-function chloride channelopathy of glial cells.. PMID: 27445142
  7. Starvation of Muller cells increased the glutamate uptake capacity as well as the expression of the most abundant glutamate transporter, EAAT1. PMID: 27196320
  8. A heterozygous SLC1A3 c.1177G4A mutation has been detected in a patient with late-onset episodic ataxia. Same heterozygous mutation was identified in one clinically affected family member and two asymptomatic members. PMID: 27829685
  9. We consider an association between SLC1A3 and the behavioural problems which can also be considered a contributing factor to behavioural problems in larger duplications overlapping the 5p13 microduplication syndrome region. PMID: 27296938
  10. In combination with other nearby residues, Arg-388 coordinates anion channel gating and forms part of the missing structural link between the anion conducting and substrate transport states in EAAT1. PMID: 26683197
  11. There was no association between pyramidal cell EAAT1 splice variant expression and schizophrenia. PMID: 26057049
  12. data provide additional insights into the mechanism by which substrates gate the anion conductance in EAATs and suggest that in EAAT1, Arg-388 is a critical element for the structural coupling between the substrate translocation and the gating mechanisms PMID: 26203187
  13. discovering compounds that can enhance EAAT1 expression and activity may be a novel strategy for therapeutic treatment of glaucoma. PMID: 25789968
  14. EAAT1 polymorphism which is involved in the Regulation of extracellular glutamate concentrations, influences Cognitive performances with a detrimental effect of T/T homozygosis. PMID: 25660734
  15. Its dysregulation may contribute to the pathology and possibly affect the onset of fragile X-associated tremor/ataxia syndrome. PMID: 24332449
  16. Increased SLC1A3 expression in the cerebellum of elderly schizophrenia patients indicates facilitated transport and may result in reduced glutamate neurotransmission. PMID: 22424243
  17. Plasma membrane EAAT1 (and NCX1)are both involved in glutamate-induced ATP synthesis. PMID: 23913256
  18. Decreased expression of EAAT1 protein remodels glutamate neurotransmission in the superior temporal gyrus in schizophrenia. PMID: 23356950
  19. Episodic ataxia type 6 represents the first human disease found to be associated with altered function of excitatory amino acid transporter anion channels. PMID: 23107647
  20. Close functional similarities of the GLAST/EAAT-1 promoter regions in man and rat exist which point to a species-specific function of the GLAST/EAAT-1 3'-UTR in constitutive and regulated GLAST/EAAT-1 expression. PMID: 22252783
  21. EAAT-1 expression was found in 91% of choroid plexus tumors and was absent in endolymphatic sac tumors. PMID: 22706862
  22. Letter: report expression of dishevelled-3 and EAAT1 and glutamine metabolism in malignant pleural mesothelioma. PMID: 22569537
  23. The accessibility in the external part of the TM5 of the glutamate transporter EAAT1 is conformationally sensitive during the transport cycle. PMID: 22292083
  24. These results indicate that E219D is a functional SLC1A3 variant that is presented in a small number of individuals with Tourette syndrome. PMID: 21233784
  25. water and urea permeation properties of wild-type EAAT1 and two mutant transporters were measured to identify which permeation pathway facilitates the movement of these molecules PMID: 21732909
  26. A series of single cysteine substitutions in the helical hairpin HP2 of excitatory amino acid transporter 1 form intersubunit disulfide cross-links within the trimer. PMID: 21876140
  27. There is no association between SLC1A3 and normal tension glaucoma (NTG), suggesting that the SLC1A3 gene may not be an associated factor in NTG pathogenesis. PMID: 21528001
  28. Dose-dependent modulation of EAAT1-mediated aspartate transport by benzodiazepines suggests a role of glial as well as neuronal transporters in drug action. PMID: 11792462
  29. EAAT1 was strongly expressed in a subset of cortical pyramidal neurons in dementia cases showing Alzheimer-type pathology. In addition, tau (which is a marker of neurofibrillary pathology) colocalized to those same pyramidal cells that expressed EAAT1 PMID: 11826152
  30. Data show that excitatory amino acid transporter (EAAT)-1 was expressed by activated macrophages/microglia in all HIV-infected cases but not in HIV-negative controls. PMID: 12769187
  31. To test whether Nedd4-2, SGK1, SGK3 and protein kinase B regulate EAAT1, cRNA encoding EAAT1 was injected into Xenopus oocytes with or without injection of Nedd4-2, constitutively active[CA] S422DSGK1, inactive K127NSGK1, SGK3 and/or CA T308D,S473DPKB PMID: 12911626
  32. Transcriptional regulation of human excitatory amino acid transporter 1 (EAAT1): cloning of the EAAT1 promoter and characterization of its basal and inducible activity in human astrocytes. PMID: 14713304
  33. We observed decreased glutamate uptake V(max), without modification of transporter affinity, in aging, which could be linked to the selective decrease of EAAT1 expression and mRNA. Moreover, in AD patients we found a further EAAT1 reduction. PMID: 14749132
  34. Only activated macrophages/microglia (AMM) expressed EAAT-1. Proportion of AMM expressing EAAT-1 did not correlate with severity of neuronal apoptosis, spongiosis, astrocytosis, microgliosis, or PrP deposition, but only with disease duration. PMID: 15535133
  35. EAAT1 parameters were mutually correlated (p<0.01) and correlations were shown with dementia severity (p<0.05 MMSE-expression, p<0.005 MMSE-mRNA). PMID: 15718040
  36. Genetic variation in SLC1A3 may contribute to susceptibility to ADHD. PMID: 15950021
  37. EAAT1ex9skip splice variant is a negative regulator of full-length EAAT1 function in the human brain PMID: 16042756
  38. Our data show that a heterozygous mutation in EAAT1 can lead to decreased glutamate uptake, which can contribute to neuronal hyperexcitability to cause seizures, hemiplegia, and episodic ataxia. PMID: 16116111
  39. the activity of glutamate transporter GLAST/EAAT1 can effectively regulate the cell surface expression of glutamine/neutral amino acid transporter ASCT2 in human fetal astrocytes PMID: 16516348
  40. Rearrangements in the tertiary structure of the EAAT1 translocation pore during transport provide constraints for modeling the structural dynamics associated with transport. PMID: 16877378
  41. SLC1A3 is unlikely to be a major susceptibility gene for schizophrenia in the Japanese population. PMID: 17221839
  42. Activity of GLAST directs FXYD2 protein/gamma subunit to the cell surface, that leads to the activation of the astroglial sodium pump. PMID: 17316900
  43. Continued expression of GLAST by neural progenitor cells in the transgenic mouse brain raises the possibility that GLAST may have an unanticipated role in regulating their behavior. PMID: 17581948
  44. We documented for the first time the expression of the mGluR5 and EAAT1 in MG-63 cells, as well as the ability of dexamethasone to upregulate the expression of the mGluR5 and EAAT1 in the MG-63 cells. PMID: 17627080
  45. Mutations in transmembrane domains 5 and 7 of the human excitatory amino acid transporter 1 affect the substrate-activated anion channel PMID: 17676873
  46. No pathogenic mutation were identified in SLC1A3. PMID: 18446307
  47. increased expression in the prefrontal cortex of chronic alcoholics PMID: 18657127
  48. analysis of the importance of Leu-303 or its counterpart Leu-391 in human EAAT1 (hEAAT1) PMID: 18678877
  49. We broadened the clinical spectrum associated with SLC1A3 mutations to include milder manifestations of EA without seizures or alternating hemiplegia. The severity of EA6 symptoms is related to the extent of glutamate transporter dysfunction. PMID: 19139306

Show More

Hide All

Involvement in disease
Episodic ataxia 6 (EA6)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A3 subfamily
Tissue Specificity
Detected in brain. Detected at very much lower levels in heart, lung, placenta and skeletal muscle. Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia.
Database Links

HGNC: 10941

OMIM: 600111

KEGG: hsa:6507

STRING: 9606.ENSP00000265113

UniGene: Hs.481918

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*