Recombinant Human F-box only protein 7 (FBXO7)

Code CSB-YP008516HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008516HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008516HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP008516HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP008516HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
FBXO7
Uniprot No.
Alternative Names
F-box only protein 7 FBXO7 FBX7
Species
Homo sapiens (Human)
Expression Region
1-522
Target Protein Sequence
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes BIRC2 and DLGAP5. Plays a role downstream of PINK1 in the clearance of damaged mitochondria via selective autophagy (mitophagy) by targeting PRKN to dysfunctional depolarized mitochondria. Promotes MFN1 ubiquitination.
Gene References into Functions
  1. Fbxo7 deficiency is associated with reduced cellular NAD(+) levels, which results in increased mitochondrial NADH redox index and impaired activity of complex I in the electron transport chain. PMID: 27689878
  2. Structure and function of Fbxo7 in Parkinson's disease has been summarized. (Review) PMID: 26965690
  3. Gsk3beta and Tomm20 are substrates of the SCFFbxo7/PARK15 ubiquitin ligase associated with Parkinson's disease PMID: 27503909
  4. Mutations in the F-box only protein 7 (FBXO7) gene, located on chromosome 22q12-q13, have been identified as having distinct clinical features in patients with hereditary Parkinson's disease (PD). PMID: 26882974
  5. The mutations of F-box protein 7 (FBXO7) gene (T22M, R378G and R498X) are associated with autosomal recessive juvenile-onset Parkinson's disease We demonstrated wild-type FBXO7 is a stress response protein with both cytoprotective and neurotoxic roles PMID: 26310625
  6. This is first time a FBXO7 mutation has been identified that causes phenotype compatible with typical idiopathic Parkinson's disease and presents with some of its common nonmotor features PMID: 26010069
  7. High expression of PARK15 might lead to the occurrence of non-small-cell lung cancer. PMID: 26245297
  8. genetic analysis of this Turkish family and the Italian PARK15 family reported previously revealed that the c.1492C > T mutation is present on two different haplotypes in the Italian family PMID: 25085748
  9. in addition to the parkinsonian-pyramidal phenotype, in connection with FBXO7 mutations and points to an intrafamilial phenotypic variation PMID: 25169713
  10. Cys52 variant of FBXO7 may contribute to reduced Parkinson's disease susceptibility in Chinese PMID: 25029497
  11. The involvement of the FBXO7 gene in PD is very rare, at least in this population from southern Spain. PMID: 24112787
  12. The crystal structure of the Fbxo7 FP domain is reported at 2.0 A resolution. The Fbxo7 FP domain adopts an alpha/beta-fold similar to that of the PI31 FP domain. PMID: 24419388
  13. A mutational analysis of the FBXO7 gene in Taiwanese patients with Parkinson's disease (PD) does not show a potential pathophysiological role in PD. PMID: 23352116
  14. This study showed that Fbxo7 participates in mitochondrial maintenance through direct interaction with PINK1 and Parkin and acts in Parkin-mediated mitophagy. PMID: 23933751
  15. An important role is suggested for FBXO7 in the pathogenesis of synucleinopathies, including Parkinson's disease and multiple system atrophy. PMID: 23656991
  16. Mutations in FBX07 is often associated with rapidly progressive parkinsonism and with additional features including pyramidal signs, cognitive decline and loss of sustained Levodopa responsiveness. PMID: 23196729
  17. analysis of the zebrafish model of Fbxo7 mutations with a role in levodopa-responsive parkinsonism with severe loss of nigrostriatal dopaminergic neurons PMID: 23133663
  18. [review] PARK15-associated parkinsonism, also referred to as parkinsonian-pyramidal disease (PPD), is caused by mutations in the F-box only protein 7 gene FBXO7. PMID: 23318512
  19. FBXO7 is a negative regulator of NF-KB signalling, modulating ubiquitination of several components of the TNF-R1 signalling complex and ultimately lowering NF-KB signalling activity. PMID: 22212761
  20. activity of FBXO7 in the nucleus appears therefore crucial for the maintenance of brain neurons and the pathogenesis of PARK15 PMID: 21347293
  21. Fbxo7 negatively regulates the proliferation and differentiation of haematopoietic progenitor cells in a p53-dependent manner PMID: 21695055
  22. Skp1 binding prevented Fbxo7 from contacting CRM1. PMID: 21378169
  23. We identified genetic deficits in FBXO7 that were associated with Levodopa responsive parkinsonism with pyramidal signs. PMID: 20669327
  24. FBXO7 mutations may be rare in Chinese early-onset Parkinsonism patients. PMID: 20603184
  25. Fbx7 functions in the SCF complex regulating Cdk1-cyclin B-phosphorylated hepatoma up-regulated protein (HURP) proteolysis by a proline-rich region PMID: 15145941
  26. a model for FP domain-mediated dimerization of SCF(Fbxo7) and PI31 PMID: 18495667
  27. Recessive FBXO7 mutations cause progressive neurodegeneration with extrapyramidal and pyramidal system involvement, delineating a novel genetically defined entity that we propose to designate as PARK15. PMID: 19038853

Show More

Hide All

Involvement in disease
Parkinson disease 15 (PARK15)
Subcellular Location
Cytoplasm. Nucleus. Mitochondrion. Cytoplasm, cytosol.
Database Links

HGNC: 13586

OMIM: 260300

KEGG: hsa:25793

STRING: 9606.ENSP00000266087

UniGene: Hs.5912

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1