Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FGF3

Uniprot No.

P11487

Research Area

Others

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

18-239aa

Target Protein Sequence

AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human FGF3 protein is produced by manipulating the expression of specific genes in e.coli cells. A DNA sequence encoding the Human FGF3 protein (18-239aa) is fused to an expression vector and subsequently transformed into e.coli cells. The cells that successfully integrate the vector are selected and cultured to induce the expression of the desired protein. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. The recombinant Human FGF3 protein protein is then purified using affinity purification, achieving a purity level of over 85%, as confirmed by SDS-PAGE analysis.

Target Background

Function

Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal ear development.

Gene References into Functions

FGFR1 and/or FGF3 gene amplification correlated with a lower pathologic complete response in patients with HER2(+) early breast cancer treated with neoadjuvant anti-HER2 therapy PMID: 28381415
fibroblast growth factor receptor 3 missense mutations were identified in 5 cases of thanatophoric dysplasia PMID: 28249712
MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors. PMID: 26421711
analysis provided evidence for gene-gene interaction between FGF3 (rs4980700) and PAX9 (rs2073242), increasing risk for isolated oral clefts (p = 0.0003). FGF3 is associated with oral clefts and may interact with PAX9. PMID: 24697712
haplotypes may contribute to the tendon disease process in elite volleyball athletes PMID: 24661680
FGF3 gene expression is altered in a human breast cancer progression model. PMID: 25333703
Higher FGF-23 concentration was associated with LVED mass and with incident atrial fibrillation and may, in part, explain the link between chronic kidney disease and AF. PMID: 24920722
A de novo 290 kb interstitial duplication of chromosome 11q13.3 including the FGF3 and FGF4 genes. PMID: 24120895
tooth agenesis had increased risk of a family history of cancer. tooth agenesis was associated with positive self-reported family history of cancer and variants in FGF3. PMID: 23169889
This study is the first to show a significant association between coronary calcification and elevated serum FGF 23 in children. PMID: 21359960
confirm the absence of otodental syndrome in heterozygous FGF3 carriers, but report unilateral microtia in one of them PMID: 21480479
Manifestations of recessive FGF3 mutations range from fully penetrant LAMM syndrome to deafness with residual inner ear structures and, by extension, with minimal syndromic features. PMID: 21306635
alterations in dosage of the Fgf3 gene cause dental morphological changes PMID: 20018768
labyrinth aplasia, microtia, and microdontia (LAMM) syndrome, caused by mutations in FGF3 PMID: 19950373
These findings suggest that the nuclear form of FGF3 inhibits cell proliferation by interfering with ribosomal biogenesis. PMID: 16263090
Development of the inner ear is completely disturbed at a very early stage--or the otic vesicle is not induced at all--in all of the affected individuals who carried two mutant FGF3 alleles PMID: 17236138
FGF3, FGF7, FGF10, FGF18, and FGFR1 may have roles in nonsyndromic cleft lip and palate PMID: 17360555
Implication of FGF3 and FADD in human craniofacial disease. PMID: 17656375
sequenced the FGF3 gene in 10 unrelated families in which probands had congenital deafness associated with various inner ear anomalies, including Michel aplasia, with or without tooth or external ear anomalies. PMID: 18435799
study identified a homozygous missense mutation (c.196G-->T) in FGF3 in 21 affected individuals from a large extended family phenotypically characterized by autosomal recessive syndromic congenital sensorineural deafness, microtia and microdontia PMID: 18701883
Loss of FGFR3 signaling provides evidence that extracellular signals regulate not simply the proliferation or survival of radial glial cells, but specifically their progression to intermediate progenitor cells during neurogenesis in vivo. PMID: 19923290

Hide All

Involvement in disease

Deafness with labyrinthine aplasia, microtia and microdontia (LAMM)

Subcellular Location

Secreted.

Protein Families

Heparin-binding growth factors family

Database Links

HGNC: 3681

OMIM: 164950

KEGG: hsa:2248

STRING: 9606.ENSP00000334122

UniGene: Hs.37092

Code	CSB-EP008630HU
Abbreviation	Recombinant Human FGF3 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Fibroblast growth factor 3 (FGF3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage