Recombinant Human Follistatin (FST)

Code CSB-MP009024HU(F2)
Abbreviation Recombinant Human FST protein
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Activin-binding protein
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
30-317aa
Target Protein Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.9 kDa
Protein Length
Full Length of Mature Protein of Isoform 2
Tag Info
C-terminal mFc2a-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.56.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH).
Gene References into Functions
  1. these studies suggest that follistatin expression in invasive breast cancer is unrelated to the disease severity and the risk of recurrence, but is more intense in estrogen receptor -negative tumors PMID: 27389553
  2. Surface plasmon resonance analysis showed no significant association between FS288 and AMHC , suggesting that FS288 indirectly regulates AMH signaling. Activin A, a direct target of FS288, did not itself induce reporter activity in P19 cells, but did prevent the FS288-induced increase in AMH signaling. Hence, local concentrations of FS288 and Activin A may influence the response of some cell types to AMH. PMID: 28500669
  3. results suggest a role for FST as a suppressor of invasion and metastasis in breast cancer PMID: 28647698
  4. These data indicate that FST is a bona fide metastasis suppressor in this mouse model and support future efforts to develop an FST mimetic to suppress metastatic progression. PMID: 28583174
  5. These findings indicate that muscle-specific Fst overexpression in pigs enhances skeletal muscle growth, at least partly due to myofiber hypertrophy and providing a promising approach to increase muscle mass in pigs and other livestock. PMID: 27787698
  6. High follistatin expression is associated with lung adenocarcinoma. PMID: 26950277
  7. FST and KLK6 may have significance in breast cancer detection PMID: 27168011
  8. Follistatin and activin A are higher in MI than in CAD suggesting increased release due to myocardial necrosis. They can predict MI with accuracy similar to CK-MB PMID: 28732565
  9. The activin-A to follistatin ratio may play a role in determining the clinical phenotype of preterm birth as preterm labor or preterm premature rupture of membranes. PMID: 27159193
  10. Low follistatin expression is associated with liver cirrhosis. PMID: 27399349
  11. Follistatin levels are associated with circulating leptin levels and display a day-night rhythm and a menstrual cycle, but not a seasonal, variation. PMID: 27621181
  12. Within the nonalcoholic fatty liver disease group of patients, follistatin was associated with steatohepatitis independently from activin A PMID: 27621190
  13. annexin A2 but not follistatin is expressed in hepatocellular carcinoma PMID: 26189841
  14. FST plays a role in tumourigenesis, metastasis and angiogenesis of solid tumours through its interaction with activin and BMPs, thus resulting in pathophysiological function. In terms of diagnosis, prognosis and therapy, FST has shown strong promise PMID: 27807065
  15. Study shows that INHBA and FST are induced by seminal fluid in cervical tissues and thus, may contribute to regulation of the post-coital response in women. PMID: 26415587
  16. Circulating follistatin may be a marker of the glucagon-to-insulin tone on the liver PMID: 26652766
  17. serum concentrations positively associated with serum free thyroxine levels in hyperthyroid or euthyroid patients PMID: 26844494
  18. We report here an original observation that activin-B is upregulated in the human idiopathic pulmonary fibrosis lung. PMID: 25361680
  19. changes in Follistatin levels during pregnancy contribute to the control of the activin A system PMID: 25565002
  20. Two angiogenic factors, follistatin (and HGF) are associated with prognosis in esophageal cancer patients. PMID: 25885021
  21. Adenomyotic tissues express high levels of myostatin, follistatin, and activin type II receptors. PMID: 26086422
  22. an imbalance between activin-A and follistatin contributes to the pathogenesis of cigarette smoke-induced inflammation and COPD PMID: 24232707
  23. Circulating follistatin levels are reduced in gestational diabetes mellitus and are positively associated with fetal growth and neonatal adiposity. PMID: 24763182
  24. higher than normal serum values common in H1N1 infection but found no association with the severity of respiratory failure PMID: 24885241
  25. data strongly support that up-regulation of FST in chondrocytes by skeletal dysplasia-inducing TRPV4 mutations contributes to disease pathogenesis. PMID: 24577120
  26. Follistatin, by its ability to neutralize the actions of activin A may be of value as an antifibrotic for radiation induced fibrosis. PMID: 24204752
  27. Plasma follistatin is moderately elevated in patients with type 2 diabetes. PMID: 23564759
  28. It is considered to have a significant role during tumor progression by influencing angiogenesis and metastasis. Thus, it serum level is a good tumor marker for hepatocellular carcinoma. PMID: 23432377
  29. These results suggest that FOXL2 may act as a tumor suppressor in human adult-type GCTs by inducing follistatin expression, which subsequently inhibits activin-stimulated cell proliferation. PMID: 24332943
  30. study found that causative mutations in the coding region of the FST gene are rare in Chinese women with idiopathic premature ovarian failure PMID: 23113792
  31. In cultured endometrioma stromal cells, Il-1beta and TNF-alpha induced follistatin mRNA and protein. PMID: 23171678
  32. FOXL2 expression is required for GDF-9 stimulation of follistatin transcription. PMID: 23523567
  33. methylation levels of CpG sites in the FST promoter and 5'-UTR are not associated with polycystic ovary syndrome PMID: 23265961
  34. The intrinsic PK/PD properties of native FST315 are poorly suited for acting as a parentally administered biotherapeutic with broad systemic effects. PMID: 23249626
  35. Serum measurements of activin A, B, or follistatin cannot discriminate risk for type 2 diabetes in individual patients, but the activins display a positive relationship with clinical parameters of the disease. PMID: 23304117
  36. The present study demonstrated that serum follistatin is not significantly altered in peritoneal or deep infiltrating endometriosis and has limited diagnostic accuracy in the diagnosis of ovarian endometrioma. PMID: 22416010
  37. Binding of a specific ligand to FS288 differentially regulates its affinity and behavior for heparin molecules. PMID: 22809401
  38. FST is known to be an inhibitor of bone morphogenetic proteins (BMPs), which, coupled with the ability of TGF-beta2 to upregulate FST levels, may indicate a possible role of FST in the pathogenesis of glaucoma. PMID: 23010638
  39. The occurrence of the exonic variants of follistatin gene seems to be dependent on the ethnic background of the subjects under study and its role in the polycystic ovary syndrome pathophysiology cannot be established with hitherto available evidence. PMID: 23023351
  40. Findings suggest a function for breast cancer susceptibility gene 1 (BRCA1) as a regulator of follistatin (FST) expression and function in ovarian cells. PMID: 22685544
  41. Myostatin may have a role in abdominal obesity, androgen and follistatin levels in women with polycystic ovary syndrome PMID: 22693174
  42. After eccentric exercise, postmenopausal women not using hormone therapy (HT) expressed higher levels of follistatin while postmenopausal women using HT showed a significant increased expression over controls. PMID: 22395277
  43. Follistatin showed highly significant positive associations to the intrafollicular concentrations of antimullerian hormone and inhibin B. PMID: 21846490
  44. LIR was able to induce gains in 1RM and quadriceps CSA similar to those observed after traditional HI. These responses may be related to the concomitant decrease in MSTN and increase in FLST isoforms, GASP-1, and SMAD-7 mRNA gene expression. PMID: 21900845
  45. analysis of candidate genes revealed four genes that influence fertility: CGB/LHB gene cluster (p = 0.0036), FSHR (p = 0.023), FST (p = 0.023), and INHB; none of the independent SNPs in these genes predicted mortality PMID: 21222045
  46. increased follistatin levels occurred with inflammation, reduced muscle strength, and low bone mineral density, suggesting an involvement of a mechanism including follistatin in the uremic wasting process PMID: 21350111
  47. Disturbed expression of endometrial activin A, cripto , and follistatin suggests a dysfunction of the activin pathway in endometriosis/endometrioma. PMID: 21496809
  48. Effects of training and androgens on MYOPRO and FOLLI concentrations in blood and skeletal muscle, were investigated. PMID: 20801187
  49. Nucleolar follistatin promotes cancer cell survival under glucose-deprived conditions through inhibiting cellular rRNA synthesis. PMID: 20843798
  50. Changes in hepatically metabolised follistatin during and after exercise are reported. PMID: 21068158

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Isoform 1 is the predominant isoform in serum but is undetectable in follicular fluid. In the embryo, strong expression is seen in the palatal epithelia, including the medial edge epithelial and midline epithelial seam of the palatal shelves. Less pronoun
Database Links

HGNC: 3971

OMIM: 136470

KEGG: hsa:10468

STRING: 9606.ENSP00000256759

UniGene: Hs.9914

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*