Recombinant Human Follistatin-related protein 1 (FSTL1), partial

Code CSB-EP613266HU1
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FSTL1
Uniprot No.
Research Area
Cardiovascular
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
176-285aa
Target Protein Sequence
ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
43.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter. Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes. Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors.
Gene References into Functions
  1. In cultured human pulmonary artery smooth muscle cells, hypoxia-promoted cellular viability, DNA synthesis and migration were suppressed by exogenous FSTL1 but enhanced by small interfering RNA targeting FSTL1 PMID: 28361925
  2. Study suggests that follistatin like 1 plays an important role in lung fibrosis, and may serve as a novel therapeutic target for treatment of silicosis. PMID: 28341862
  3. Segmental allergen challenge increases levels of airway follistatin-like 1 in patients with asthma. PMID: 27001159
  4. Study found that FSTL1 was downregulated in non-small cell lung cancer (NSCLC) cells. FSTL1 overexpression suppressed tumor cell proliferation, altered cell cycle and induced apoptosis in addition to inhibiting cell survival, migration and invasion. Altogether, results revealed the critical tumor-suppression function of FSTL1 in NSCLC progression, suggesting it as an important factor in NSCLC progression. PMID: 29115636
  5. Smad3 knockdown could restore the inhibition of cell proliferation induced by FSTL1 overexpression in MDAMB231FSTL1 cells, indicating that the antiproliferative effect of FSTL1 overexpression may be associated with Smad3 involved TGFbeta signaling pathway regulation. This study identified FSTL1 as an inhibitor of cell proliferation in MDAMB231 and 231BR cell lines PMID: 29048681
  6. Dendritic cell-mediated immunity was activated by FSTL1. PMID: 29135371
  7. Fstl1serves an important role in liver fibrosis and target deletion of Fstl1 attenuated HSCs activation through suppressing TGFbeta1/Smad3 signaling pathway. PMID: 28901425
  8. Results showed that: 1- FSTL-1 expression is localized to the stromal compartment of the pancreas; 2- FSTL-1 expression is reduced in pancreatic cancer, and 3- FSTL-1 inhibited pancreatic cancer cell proliferation. PMID: 27886258
  9. Data show that follistatin-like 1 (FSTL1) contributed to unfavorable post-surgical outcome of hepatocellular carcinoma (HCC) patients via inhibiting cell apoptosis. PMID: 28655132
  10. results indicate that rs1259293 is associated with an increased risk and unfavorable postoperative prognosis of renal cell carcinoma, possibly by down-regulating FSTL1 expression in renal tissues. PMID: 27225192
  11. Data provide evidence that FSTL1 modestly affects the proliferation of breast cancer cells and vascular endothelial cells. These findings improve the understanding of the functions of FSTL1 in breast cancer development and angiogenesis. PMID: 28857515
  12. knockdown of FSTL1 inhibited ASM cell proliferation and migration induced by PDGF-BB at least partially via inhibiting the activation of ERK and AKT. These results provide novel insight into the pathogenesis of airway remodeling in childhood asthma and FSTL1 may be a possible therapeutic strategy for the treatment of asthma. PMID: 28393245
  13. Fstl1 inhibited Smad1/5/8 phosphorylation by blocking the association between bone morphogenetic protein 4 and Bone Morphogenetic Protein Receptors, Type II via competitive binding to bone morphogenetic protein 4. PMID: 29212066
  14. Data show that follistatin like-1 (FSTL1) was frequently downregulated in nasopharyngeal carcinoma (NPC) cell lines and primary tumor biopsies by promoter hypermethylation. PMID: 26918942
  15. Results indicate the significance of follistatin-like protein 1 (FSTL1) in driving oncogenesis and metastasis in esophageal squamous cell carcinoma (ESCC) by coordinating NF-kappa B (NFkappaB) and bone morphogenetic proteins (BMP) pathway control. PMID: 28883005
  16. FSTL1 mRNA levels increased in castration-resistant prostate cancer in association with predominantly nuclear FSTL1. PMID: 27976415
  17. FSTL1 may induce epithelial mesenchymal transition and airway remodeling by activating autophagy. PMID: 28473327
  18. DROMs levels positively associated with Fstl1, Hemoglobin A1c and hsCRP levels. PMID: 27145224
  19. FSTL1 displays anti-inflammatory effects against oxidized low-density lipoprotein-induced pro-inflammatory cytokine production via a mechanism that involves the TLR4/MyD88/NF-kappaB and MAPK signaling pathways. PMID: 27569284
  20. this study shows that 1) the expression of follistatin-like protein 1 is upregulated in rheumatoid arthritis patients; 2) miR-27a inhibits cell migration of rheumatoid arthritis synoviocytes by targeting follistatin-like protein 1 and restraining the TLR4/NFkappaB pathway PMID: 27498552
  21. FSTL1 plays a critical role in immune regulation, enhancing the antigen presentation ability of dendritic cells by up-regulating NF-kappab expression and down-regulating JNK expression. PMID: 27859422
  22. the knockdown of FSTL1 induces apoptosis through a mitotic arrest and caspase-dependent cell death. FSTL1 plays the important roles in cellular proliferation and apoptosis in lung cancer cells, and thus can be a new target for lung cancer treatment. PMID: 26716515
  23. Children with chronic heart failure group had a significantly higher serum level of FSTL1 than the control group. PMID: 26903060
  24. provide mechanistic insight into the regulation of erythropoiesis by FSTL1 signaling and lay a foundation for exploring FSTL1 signaling as a therapeutic target for anemia PMID: 26365350
  25. FSTL1 is elevated in patients with osteoarthritis and involved in the progression of synovial inflammation. PMID: 25888873
  26. administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation PMID: 26355153
  27. data suggest that the loss of epicardial FSTL1 is a maladaptive response to injury, and that its restoration would be an effective way to reverse myocardial death and remodelling following myocardial infarction in humans PMID: 26375005
  28. Fstl1 is induced in response to lung injury and promotes the accumulation of myofibroblasts and subsequent fibrosis. These data suggest that Fstl1 may serve as a novel therapeutic target for treatment of progressive lung fibrosis. PMID: 25584011
  29. FSTL1 is elevated in various inflammatory conditions and decreased during the course of treatment. FSTL1 may therefore be a valuable biomarker for such diseases. PMID: 24838142
  30. FSTL1 is a potential mediator of inflammation and insulin resistance in obesity. PMID: 24347831
  31. These results suggest that FSTL-1 may act on the NLRP3 inflammasome to promote IL-1beta secretion from monocytes/macrophages. PMID: 24470197
  32. results demonstrated that follistatin-like protein 1 (Fstl1) is expressed and secreted by human myotubes and plasma Fstl1 levels are increased after exercise PMID: 23419164
  33. A clear inverse correlation between the expression pattern of FSTL1 (pro-migratory) and miR-198 (anti-migratory) highlights the importance of this regulatory switch in controlling context-specific gene expression to orchestrate wound re-epithelialization. PMID: 23395958
  34. Data show that the serum and synovial fluid (SF) FSTL1 levels were markedly higher in female OA patients than in males. PMID: 22117761
  35. FRP has the function of evoking innate immune responses as one of the endogenous TLR4 agonists. PMID: 22265692
  36. Elevated FSTL1 levels reflect not only joint diseases but also inflammation and tissue degradation in systemic autoimmune diseases. PMID: 21303509
  37. These data suggest that Cx43 inhibits the invasion and metastasis of pulmonary giant cell carcinoma cells by modulating the secretion of FSTL1, which is regulated by histone acetylation. PMID: 21718795
  38. DIP2A could be a cell-surface receptor protein and mediate a FOS down-regulation signal of FRP. FRP bound to DIP2A and CD14, and also with proteins of the TGF-beta superfamily PMID: 20860622
  39. Whilst follistatin expression is unchanged, follistatin-related gene is down-regulated in endometrial carcinoma. PMID: 15296481
  40. FRP mRNA is overexpressed in rheumatoid arthritis synovium, the product of which exerts inhibitory activity on synovial cell growth PMID: 15638044
  41. TSC-36 can be induced in VSMCs (vascular smooth muscle cells) and inhibits VSMCs proliferation in vitro and in vivo. PMID: 16256108
  42. Elevated myocardial expression of FST-like genes is a feature of heart failure and may be linked to both disease severity and mechanisms underlying recovery. PMID: 18617621
  43. Fstl1 is a secreted muscle protein or myokine that can function to promote endothelial cell function and stimulates revascularization in response to ischemic insult through its ability to activate Akt-eNOS signaling PMID: 18718903
  44. Cell migration and invasion assays demonstrated a remarkably lower cell migration and invasion capability in FSTL1-transfected cells in relation to downregulation of matrix metallopeptidase-2 PMID: 18796737
  45. FSTL-1 is overexpressed by 2-3-fold in synovial tissues of rheumatoid arthritis patients compared with control synovium obtained from subjects undergoing knee arthroscopic anterior cruciate ligament repair. PMID: 19109154

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Overexpressed in synovial tissues from rheumatoid arthritis.
Database Links

HGNC: 3972

OMIM: 605547

KEGG: hsa:11167

STRING: 9606.ENSP00000295633

UniGene: Hs.269512

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*