Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IFI30

Uniprot No.

P13284

Research Area

Immunology

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-232aa

Target Protein Sequence

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.4 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-232 constitute the expression domain of recombinant Human IFI30. This IFI30 protein is theoretically predicted to have a molecular weight of 27.4 kDa. This IFI30 recombinant protein is manufactured in mammalian cell. The IFI30 coding gene included the C-terminal 10xHis tag, which simplifies the detection and purification processes of the recombinant IFI30 protein in following stages of expression and purification.

Gamma-interferon-inducible lysosomal thiol reductase (IFI30) plays a crucial role in antigen processing within lysosomal compartments. It is induced by gamma-interferon and is primarily expressed in antigen-presenting cells, such as dendritic cells, macrophages, and B cells. IFI30 contributes to the degradation of protein antigens by reducing disulfide bonds, thereby facilitating their unfolding and subsequent processing for presentation on major histocompatibility complex class II (MHC-II) molecules. This process is vital for the activation of CD4⁺ T cells and the adaptive immune response. IFI30's involvement in antigen processing highlights its significance in immune surveillance and the body's defense against infections and diseases.

Target Background

Function

Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.

Gene References into Functions

Results shows that GILT expression is required for downregulation of PAX-3 proteins in late stage human melanoma cells. GILT co-localizes with PAX-3 proteins regulating its expression through the autophagy and lysosomal degradation pathway in human melanoma cells. PMID: 28857256
GILT functions as a host restriction factor against the retroviruses. PMID: 27655726
GILT expression is anticipated to result in improved presentation of melanoma antigens and more effective antimelanoma T-cell responses. PMID: 26930048
The lysosomal thiol reductase GILT expressed by antigen-presenting cells has diverse cellular and organismal functions. (Review) PMID: 26116226
this review discusses recent studies that have advanced our understanding of the role of GILT in antigen processing and revealed surprising new functions for the enzyme.[review] PMID: 23246037
Single nucleotide polymorphism of the interferon-gamma-inducible protein 30 gene is associated with hyperglycemia in severely obese individuals. PMID: 21701784
GILT is required for efficient histocompatiblity class II-restricted processing of melanoma antigen tyrosinase-related protein 1 epitope in vitro and accelerates the onset of vitiligo in TRP1-specific T-cell receptor transgenic mice. PMID: 20668223
Absence of gamma-interferon-inducible lysosomal thiol reductase in melanomas disrupts T cell recognition of select immunodominant epitopes. PMID: 12021307
Role of the C-terminal propeptide in the activity and maturation of gamma -interferon-inducible lysosomal thiol reductase (GILT). PMID: 12198183
GILT-expressing melanoma cells could prove to be very promising for direct antigen presentation and CD4+ T cell recognition PMID: 18343923
studied gene expression profile of brain lesions of a patient with Neuromyelitis optica by using DNA microarray; found marked up-regulation of interferon gamma-inducible protein 30 (IFI30), CD163, and secreted phosphoprotein 1 (SPP1, osteopontin) PMID: 18410276

Hide All

Subcellular Location

Secreted. Lysosome.

Protein Families

GILT family

Database Links

HGNC: 5398

OMIM: 604664

KEGG: hsa:10437

STRING: 9606.ENSP00000384886

UniGene: Hs.14623

Code	CSB-MP011012HU
Abbreviation	Recombinant Human IFI30 protein, partial
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Gamma-interferon-inducible lysosomal thiol reductase (IFI30), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage