Purity
Greater than 90% as determined by SDS-PAGE.
Species
Homo sapiens (Human)
Expression Region
1-232aa
Target Protein Sequence
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-232 constitute the expression domain of recombinant Human IFI30. This IFI30 protein is theoretically predicted to have a molecular weight of 27.4 kDa. This IFI30 recombinant protein is manufactured in mammalian cell. The IFI30 coding gene included the C-terminal 10xHis tag, which simplifies the detection and purification processes of the recombinant IFI30 protein in following stages of expression and purification.
Gamma-interferon-inducible lysosomal thiol reductase (IFI30) plays a crucial role in antigen processing within lysosomal compartments. It is induced by gamma-interferon and is primarily expressed in antigen-presenting cells, such as dendritic cells, macrophages, and B cells. IFI30 contributes to the degradation of protein antigens by reducing disulfide bonds, thereby facilitating their unfolding and subsequent processing for presentation on major histocompatibility complex class II (MHC-II) molecules. This process is vital for the activation of CD4
+ T cells and the adaptive immune response. IFI30's involvement in antigen processing highlights its significance in immune surveillance and the body's defense against infections and diseases.
