Recombinant Human Glutaminyl-peptide cyclotransferase-like protein (QPCTL), partial

In Stock
Code CSB-EP868351HU
Abbreviation Recombinant Human QPCTL protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
QPCTL
Uniprot No.
Research Area
Cell Biology
Alternative Names
QPCTLGlutaminyl-peptide cyclotransferase-like protein; EC 2.3.2.5; Golgi-resident glutaminyl-peptide cyclotransferase; isoQC; gQC
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
212-382aa
Target Protein Sequence
AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Human QPCTL recombinant protein is conventionally generated by transfecting the recombinant DNA into a host cell, and then the host cells are cultured and the transfected DNA transcribed and translated. Different host cells can be chosen for recombinant protein production, the choice of which depends on the type of protein that needs to be generated, its functional activity and requisite yield. We choose E.coli as the expression system for this QPCTL protein expression because bacteria cells are easy to culture, grow fast and produce high yields of recombinant protein.

QPCTL is a protein coding gene that encodes Golgi-resident glutaminyl-peptide cyclotransferase (isoQC). According to some studies, QPCTL may have the following features.
Two insertion variants in the promoter region of the QPCTL gene were significantly associated with chicken body weight and carcass traits. QPCTL knockout mice show different substrate turnover for glutamine cyclase isoenzymes. QPCTL is essential for pyroglutamate formation at the SIRPα binding site on CD47 shortly after biosynthesis. The QPCT transcript level was higher in thyroid cancer, whereas the expression of the QPCTL gene was not affected.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the biosynthesis of pyroglutamyl peptides.
Gene References into Functions
  1. genetic association studies in Danish population: Quantitative metabolic phenotypes in obesity are associated with SNP in various genes: QPCTL (rs2287019) is associated with body mass index and increased insulinogenic index. PMID: 21953277
Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein.
Protein Families
Glutaminyl-peptide cyclotransferase family
Database Links

HGNC: 25952

KEGG: hsa:54814

STRING: 9606.ENSP00000012049

UniGene: Hs.631556

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*