Recombinant Human Glutaminyl-peptide cyclotransferase-like protein(QPCTL),partial

Code CSB-EP868351HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q9NXS2
Relevance Responsible for the biosynthesis of pyroglutamyl peptides.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Golgi-resident glutaminyl-peptide cyclotransferaseisoQC ;gQC
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL
Research Area Cell Biology
Source E.coli
Gene Names QPCTL
Expression Region 212-382aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 35.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for the biosynthesis of pyroglutamyl peptides.
Subcellular Location Golgi apparatus membrane, Single-pass type I membrane protein
Protein Families Glutaminyl-peptide cyclotransferase family
Database Links

HGNC: 25952

KEGG: hsa:54814

STRING: 9606.ENSP00000012049

UniGene: Hs.631556

Related Products

QPCTL Antibodies

QPCTL Antibodies for Homo sapiens (Human)

QPCTL Proteins

QPCTL Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.