Recombinant Human Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial(GATC)

Code CSB-EP009283HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O43716
Relevance Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Protein 15E1.2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Research Area others
Source E.coli
Gene Names GATC
Protein Names Recommended name: Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial Short name= Glu-AdT subunit C EC= 6.3.5.-Alternative name(s): Protein 15E1.2
Expression Region 1-136aa
Tag Info N-terminal GST-tagged
Mol. Weight 42.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Subcellular Location Mitochondrion
Protein Families GatC family
Database Links

HGNC: 25068

KEGG: hsa:283459

STRING: 9606.ENSP00000446872

UniGene: Hs.706889

Related Products

GATC Antibodies

GATC Antibodies for Human

GATC Proteins

GATC Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.