Recombinant Human Glutathione S-transferase A2(GSTA2)

Code CSB-EP009971HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P09210
Relevance Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Research Area Signal Transduction
Source E.coli
Gene Names GSTA2
Protein Names Recommended name: Glutathione S-transferase A2 EC= 2.5.1.18Alternative name(s): GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2
Expression Region 1-222aa
Tag Info N-terminal GST-tagged
Mol. Weight 52.7kDa
Protein Description Full Length of BC002895
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Subcellular Location Cytoplasm
Protein Families GST superfamily, Alpha family
Tissue Specificity Liver.
Database Links

HGNC: 4627

OMIM: 138360

KEGG: hsa:2939

STRING: 9606.ENSP00000420168

UniGene: Hs.94107

Related Products

GSTA2 Antibodies

GSTA2 Antibodies for Homo sapiens (Human)

GSTA2 Antibodies for Human

GSTA2 Proteins

GSTA2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.