Recombinant Human Glutathione S-transferase Mu 1 (GSTM1)

Code CSB-YP009979HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009979HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP009979HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP009979HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
GSTM1
Uniprot No.
Alternative Names
EC=2.5.1.18; Glutathione S-transferase Mu 1; GST class-mu 1; GST HB subunit 4; GST1; Gstm1; GSTM1-1; GSTM1_HUMAN; GSTM1a-1a; GSTM1b-1b; GTH4; GTM1; H-B; LIVER AND FIBROBLAST GST1; MU; MU-1
Species
Homo sapiens (Human)
Expression Region
1-181
Target Protein Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGN K
Protein Length
Full length protein of Isoform 2
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers.
Gene References into Functions
  1. Patients having Glutathione S-transferase M1 allele and Apolipoprotein E E2 allele are predisposed to oxidative stress-induced cardiac injury. PMID: 30095041
  2. The 6-TGN levels were not affected by the GSTM1 genotype. PMID: 28045129
  3. Complex Haplotypes of GSTM1 Gene Deletions Harbor Signatures of a Selective Sweep in East Asian Populations. PMID: 30061374
  4. These results illustrate the potential association between rs9642880 G > T and survival in hepatocellular carcinoma patients who received radiotherapy treatment. PMID: 29396413
  5. GSTM1 and GSTT1 gene polymorphisms are not associated with lipid levels in endogenous hypertriglyceridemia in Chinese population. PMID: 29896743
  6. This study suggests that GSTM1 active and GSTT1 null genotype combination might be a risk factor in developing mitochondrial disease. PMID: 29235020
  7. The meta-analysis showed that glutathione S-transferases GSTT1 and GSTM1 null polymorphisms are risk factors for breast cancer [Meta-analysis]. PMID: 29932073
  8. individuals carrying GSTM1 null variant showed protective role against seizure. PMID: 30179425
  9. Our meta-analysis supports that CYP1A1 exon7 polymorphism might contribute to individual susceptibility to esophageal cancer in the Chinese population. Gene-gene interaction analysis found a synergistic interaction between CYP1A1 mutation genotypes and GSTM1 deletion genotype. PMID: 28164573
  10. The effects of GSTM1/GSTT1 genes on diabetes mellitus type 2 risk are gender dependent and may be triggered by tobacco smoking. PMID: 29111615
  11. GSTM1 gene polymorphism is associated with liver diseases. PMID: 29582627
  12. this is the first report on the GSTM1and GSTT1frequency distribution among the tribal population of western India. PMID: 29666321
  13. Authors conclude that maternal GSTM1/GSTT1 gene polymorphisms present an impact on birth weight, being involved in the neonatal nutritional status. PMID: 29556619
  14. VEGF, VEGFR2 and GSTM1 polymorphisms in outcome of multiple myeloma patients treated with thalidomide-based regimens PMID: 28665417
  15. Based on our meta-analysis, the GSTM1 null genotype is a risk factor for CRC. PMID: 29516983
  16. Indel variants of GSTM1 were typed in breast cancer patients and normal controls. GSTM1 deletion seemed to marginally increase breast cancer risk in Mexican women. PMID: 29267651
  17. The current analyses suggests significant association was found between GSTM1 variants and the risk of childhood acute lymphoblastic leukemia (ALL), while no association were found between GSTT1 and GSTP1 Ile105Val polymorphism and childhood ALL risk PMID: 28176509
  18. In conclusion, the present study indicated that GSTT1 deletion was associated with increased recurrence risk of breast cancer, while GSTM1 correlated with worst prognosis parameters at diagnosis, but was negatively associated with recurrence risk in luminal subtype samples. PMID: 28455582
  19. Homozygous deletion of GSTM1 is associated with slower HIV disease progression. PMID: 29795558
  20. The patients homozygous for the GSTM1 null alleles showed a 3.5 increased risk of Alzheimer's disease PMID: 29072550
  21. Our findings suggest that the GSTM1 (-) allele may be considered as a key factor for the development of carbamazepine-induced hepatotoxicity PMID: 29523098
  22. We observed an association between GSTM1 and Stevens Johnson Syndrome Toxic Epidermal Necrolysis. PMID: 28689274
  23. Using PCR, analyzed copy number variations in glutathione S-transferase M1 (GSTM1) gene and determined their genetic contribution in Tunisian rheumatoid arthritis (RA). PMID: 28703442
  24. GSTM1 showed a significant association with several GV, arterial stiffness, and SV balance indexes. In particular, the GSTM1 deletion positively correlates with lower values of these indexes when compared to the presence of the gene. PMID: 29452132
  25. Individuals with ASD (autism spectrum disorder)showed a significant diminished level of reduced glutathione, however, the distribution of GSTT1, GSTM1, and GSTP1 polymorphisms was not found to be associated with autism in this study population. PMID: 29072241
  26. GSTM1 and GSTT1 gene polymorphisms are closely correlated with the pathogenesis of COPD. PMID: 28951769
  27. Analyses of the GSTM1 polymorphisms demonstrated that there was a significantly increased Esophageal Carcinoma risk in GSTM1 null genotype carriers (OR = 1.319, 95% CI = 1.125-1.546, p for heterogeneity <0.001).In the GSTM1-GSTT1 interaction analysis, we discovered remarkably enhanced EC risk for patients with the GSTM1 and GSTT1 dual null genotypes (OR = 1.962, 95% CI = 1.178-3.268, p for heterogeneity <0.001) PMID: 29215312
  28. The findings indicate that GSTM1 may be a causal gene of both anti-tuberculosis drug-induced hepatotoxicity and schizophrenia. (Meta-analysis) PMID: 27580934
  29. findings indicated that GSTM1 polymorphism might affect the association between exposure to perfluorinated compounds (PFCs) and birth weight, suggesting the effect of genetic susceptibility on the relationship between prenatal PFCs exposure and birth outcomes PMID: 27206125
  30. This study showed a significant trend towards an association with the combination of the GSTM1/GSTT1 double null polymorphism and generalized vitiligo. Individuals with GSTM1 null/GSTT1+ heterozygosis have a 2.97 odds protection from having generalized vitiligo compared with patients. PMID: 29641697
  31. The findings are consistent with the notion that the frequency of homozygous carriers of the GSTM1(0/0)/GSTT1(0/0) genotype is increased among males with reproductive problems. PMID: 28744640
  32. The neonates who had GSTT1 or GSTM1 polymorphism were associated with an increased risk of being small for gestational age SGA. A combination of the GSTT1 and GSTM1 null genotype exacerbated the effect of maternal environmental tobacco smoke exposure on SGA more than the presence of either genotype alone (odds ratio=8.90, 95% confidence interval=1.00-79.5). PMID: 28216421
  33. GSTT1 and GSTM1 may modulate DNA damage levels of p53 gene when exposed to polycyclic aromatic hydrocarbons. PMID: 28426525
  34. Carriers of GSTM1-null and GSTP1-variant genotypes are in increased risk of RCC development. On the contrary, GSTM1-null genotype is associated with favorable postoperative prognosis in ccRCC. PMID: 28284893
  35. Suggest that the donors and recipients' GSTM1 polymorphism may be a major risk factor for oxidative stress and delayed graft function in kidney transplant recipients. PMID: 28575886
  36. The combination of glutathione S-transferase theta 1 (GST T1) null/glutathione S-transferase mu 1 (GST M1) wild genotype was significantly more frequent in diabetic patients than controls, indicating a significantly increased risk of type 1 diabetes mellitus (T1DM). PMID: 27908841
  37. This meta-analysis demonstrates that the GSTM1-null, GSTT1-null, and GSTM1/GSTT1 double-null genotypes are associated with increased bladder cancer risk. PMID: 27911277
  38. the study findings allow us to conclude that the deletion genotypes of GSTM1 and GSTT1 are associated with infertility in Russian men. PMID: 29376593
  39. this meta-analysis indicates that the combined effects of the GSTM1 and GSTT1 polymorphisms are associated with increased lung cancer risk in Asians, Caucasians, and Indians. PMID: 28427236
  40. Our results suggest that GSTM1 and GSTT1 gene deletion/null gene polymorphisms are not a key modulators of the risk of developing colorectal cancer in Kashmiri population. PMID: 28485343
  41. People with glutathione s-transferase enzyme gene variations (GSTM1 and GSTT1 deletions) are at a higher risk for developing multiple sclerosis, which can be due to a decrease in enzymatic activity and their levels in nerve cells and the brain. PMID: 29055472
  42. The GSTM1-null genotype might be associated with higher risk for early onset severe mental disorders. PMID: 27114251
  43. Findings suggest that the GSTM1 null genotype is a risk modifier for cutaneous melanoma. PMID: 27540835
  44. We aimed to assess the impact of DE and allergen co-exposure on lung function and the influence of GSTM1 or GSTT1 variation.plasma protein carbonyl level 4h after co-exposure was higher in the individuals who have the GSTT1 null genotype PMID: 27151508
  45. Review/Meta-analysis: GSTM1 null genotype is a low-penetrant risk factor for developing breast cancer in the Chinese population. PMID: 28164656
  46. the presence of a GSTM1 *null and GSTT1 *null alleles were independent predictors for COPD in females. PMID: 27421065
  47. Our meta-analysis revealed strong association of rs1048943 in CYP1A1, but a suggestive association of deletion polymorphisms in GSTT1 and GSTM1 with lung cancer, which provides a comprehensive insight on the overall effect of the polymorphic variants, reported in various case-control studies on Indian population, on the risk of lung cancer development PMID: 29076184
  48. The selective effect of PEITC on detoxification in subjects lacking both GSTM1 and GSTT1 genes supports the epidemiologic findings of stronger protection by dietary isothiocyanates against the development of lung cancer in such individuals PMID: 27099270
  49. Polymorphisms of GSTM1 is associated with lung cancer. PMID: 28770368
  50. The loss of GSTM1 was significantly associated with incident kidney and heart failure, independent of traditional risk factors. These results suggest GSTM1 function is a potential treatment target for the prevention of kidney and heart failure PMID: 28720685

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
GST superfamily, Mu family
Tissue Specificity
Liver (at protein level).
Database Links

HGNC: 4632

OMIM: 138350

KEGG: hsa:2944

STRING: 9606.ENSP00000311469

UniGene: Hs.301961

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1