Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial

Code CSB-EP009413HU1
Abbreviation Recombinant Human GHRHR protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-127aa
Target Protein Sequence
HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.8 kDa
Protein Length
partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Gene References into Functions
  1. Mutation in GHRHR is associated with pituitary diseases. PMID: 29277338
  2. Report GHRH-R labelling of apocrine glands and neoplastic epithelium in adnexal tumours and apocrine glands of the skin. PMID: 29895126
  3. Single nucleotide variant in GHRHR gene is associated with isolated growth hormone deficiency. PMID: 28910730
  4. GHRHR mutation is associated with growth hormone deficiency. PMID: 28525353
  5. The pP79L mutation is associated with the compromise in function, with the residual partial activity explaining the mild phenotype. PMID: 27501283
  6. This is the first report to demonstrate the GHRH-R codon 72 mutation in Sri Lankan patients with confirmed growth hormone deficiency. PMID: 27031974
  7. This study shows that GHRH-R is expressed by the majority of malignant mixed Mullerian tumors in both epithelial and mesenchymal components PMID: 26535981
  8. Identification of new missense mutations and an insertion mutation for the GHRHR gene in patients with isolated growth hormone deficiency. PMID: 25541890
  9. A reduced stature in older subjects heterozygous for the c.57+1G>A GHRHR mutation, indicating different effects of heterozygosis through lifespan. PMID: 25761575
  10. we found that pGHRH-R and its main splice variant are expressed in thyroid tissue and was upregulated in tumor cells compared to normal thyroid cells PMID: 25752763
  11. Indel mutation in the growth hormone releasing hormone receptor gene is associated with isolated growth hormone deficiency. PMID: 25153028
  12. These preliminary results suggest a greater than average GHRH-R expression in invasive lobular carcinomas and invasive ductal carcinomas associated with casting-type calcifications on the mammogram. PMID: 24479854
  13. Compound heterozygous mutations of the growth hormone-releasing hormone receptor gene is associated with isolated growth hormone deficiency PMID: 23602557
  14. Genu valgum was more prevalent in growth hormone deficiency GHRHR mutation patients than controls. PMID: 24057284
  15. We report a novel splice-disrupting mutation in GHRHR in 2 siblings and provide evidence that all c.57+1G>A (IVS1+1G>A) mutant chromosomes have the same haplotype ancestor PMID: 23052699
  16. The study established the GHRHR gene sequence variation map in isolated severe growth hormone deficiency patients and normal adult height. PMID: 22489751
  17. bone quality and metabolism and its correlation with insulin sensitivity in subjects heterozygous for a null mutation in GHRHR PMID: 21995288
  18. GHRH-R and Hsp90 were found to be independent predictive factors of histopathological response to neoadjuvant RCT. PMID: 22160161
  19. study describes a new frame shift mutation in the coding sequence of exon 4 (corresponding to the extracellular domain of the receptor)(c.391delG) in the GHRHR in a family with isolated GH deficiency PMID: 21816782
  20. This chapter reviews the biology of the GHRHR, the mutations that affect its gene and their effects in homozygous and heterozygous individuals. PMID: 20374725
  21. The homozygous GHRHR mutation was rare, being detected in only one Japanese isolated GH deficiency family. PMID: 21044116
  22. The endometriotic stromal cells (ESCs) and transformed human ESCs, but not normal endometrial tissues, expressed GHRH-R mRNA. PMID: 19524226
  23. These results show, for the first time, the activation of the MAPKs cascade by the splic variant (SV1) receptor. PMID: 19897610
  24. Longevity in untreated congenital growth hormone deficiency due to a homozygous mutation in the GHRH receptor gene. PMID: 19965916
  25. To ascertain whether (splice variant) SV1 mediates mitogenic effects on nonpituitary tissues, we expressed SV1 in 3T3 mouse fibroblasts and studied the properties of the transfected cells PMID: 11773624
  26. results demonstrate that mutations in the GHRHR are not limited to the coding sequence and that promoter mutations that impair Pit-1 binding can reduce expression of the GHRHR gene PMID: 11875102
  27. human GHRHR isoforms are found in experimental prostate neoplasms in mice; this could explain the effects of GHRH antagonists on growth of prostate cancer PMID: 12126741
  28. expression of mRNA and splice variants of this receptor in human malignant bone tumors PMID: 12220726
  29. an examination of the possible clinical significance of a polymorphism in the gene of this receptor: involvement in acromegaly PMID: 12220735
  30. mutations in the GHRH receptor gene make abnormalities of this gene one of the most common causes of of isolated growth hormone deficiency--REVIEW PMID: 12424433
  31. Compound heterozygotes for two previously undescribed mutations in the GHRHR that are predicted to cause complete lack of functional GHRHR protein: a nonsense mutation in codon 43 (Q43X), and a splice mutation at the beginning of intron 3 (IVS3+1G-->A). PMID: 12444890
  32. GHRH receptor may be associated with carcinogenesis PMID: 12867592
  33. autocrine stimulatory loop between GHRH and SV1 variant of GHRH receptor in primary cancers. PMID: 15362970
  34. GHRH-R was demonstrated in prostate and breast carcinomas, opening a variety of possibilities for the use of GHRH antagonists in the treatment of prostatic and mammary tumors. PMID: 15944917
  35. analysis of receptors for growth hormone-releasing hormone in human osteosarcomas and Ewing's sarcomas PMID: 16820890
  36. Heterozygosity for a null GHRHR mutation is not associated with reduction in adult stature or in serum IGF-I but is associated with changes in body composition and possibly an increase in insulin sensitivity PMID: 17356054
  37. Size of individual abdominal organs is influenced in different ways by severe and congenital lack of GH due to a GHRH-R mutation. PMID: 18034778
  38. the expression of GHRH and its tumoral receptor SV1 in primary human melanomas and dysplastic nevi by immunohistochemistry. None of the specimens tested expressed GHRH PMID: 18255167
  39. targeting the GHRH receptor may be a therapeutic option in Triple-negative breast cancers PMID: 18629632
  40. Gsp mutations up-regulate GHRHR mRNA expression in GH-secreting pituitary adenoma cells & desensitize the adenoma cells to GHRH in terms of their GHRHR mRNA expression. PMID: 19029774
  41. GHRHR might be one of the most important genes so far identified affecting normal variation in human height. PMID: 19209235
  42. Mutations in GH1 and GHRHR were identified in 41 patients from 21 pedigrees, representing 11.1% of our cohort with a higher prevalence of mutations in familial cases (38.6%) and in consanguineous pedigrees (75%) of congenital growth hormone deficiency. PMID: 19567534
  43. Common variants of the GNRH1 and GNRHR genes are not associated with risk of invasive breast cancer in Caucasians PMID: 19640273
  44. These results provide strong evidence that the splicing mutation IVS8+1G>A of growth hormone-releasing hormone receptor is a cause of pituitary dwarfism in the Chinese family. PMID: 19733620

Show More

Hide All

Involvement in disease
Growth hormone deficiency, isolated, 1B (IGHD1B)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Pituitary gland.
Database Links

HGNC: 4266

OMIM: 139191

KEGG: hsa:2692

STRING: 9606.ENSP00000320180

UniGene: Hs.733003

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*