Recombinant Human Heart- and neural crest derivatives-expressed protein 2(HAND2)

Code CSB-EP010126HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P61296
Relevance Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Class A basic helix-loop-helix protein 26
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names HAND2
Protein Names Recommended name: Heart- and neural crest derivatives-expressed protein 2Alternative name(s): Class A basic helix-loop-helix protein 26 Short name= bHLHa26 Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed pro
Expression Region 1-180aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.3kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3' (By similarity).
Subcellular Location Nucleus
Tissue Specificity Heart.
Database Links

HGNC: 4808

OMIM: 602407

KEGG: hsa:9464

STRING: 9606.ENSP00000352565

UniGene: Hs.388245

Related Products

HAND2 Antibodies

HAND2 Antibodies for Human

HAND2 Proteins

HAND2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.