Recombinant Human Heart- and neural crest derivatives-expressed protein 2 (HAND2)

Code CSB-EP010126HU
Abbreviation Recombinant Human HAND2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
AI225906; AI661148 ; autonomic nervous system and neural crest derivatives-expressed protein 2; Basic helix loop helix transcription factor HAND2; bHLHa26; Class A basic helix-loop-helix protein 26; Deciduum; Deciduum heart autonomic nervous system and neural crest derivatives expressed protein 2; DHAND 2; dHAND; DHAND2; Ehand 2; Ehand2; FLJ16260; HAND 2; Hand2; HAND2_HUMAN; Heart and neural crest derivatives expressed 2; Heart and neural crest derivatives expressed protein 2; heart and neural crest derivatives expressed transcript 2; heart; Heart- and neural crest derivatives-expressed protein 2; Hed; Highly similar to dHAND M musculus; MGC125303; MGC125304; Th 2; Th2; Thing 2; Thing2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-180aa
Target Protein Sequence
MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.3kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'.
Gene References into Functions
  1. Study showed that thalidomide inhibited the TBX5/HAND2 physical interaction, and the in silico docking revealed that the same amino acids involved in the interaction of TBX5 with DNA are also involved in its binding to HAND2. Results establish a HAND2/TBX5 pathway implicated in heart development and diseases. PMID: 28469241
  2. HAND2 mRNA and protein low expressed in endometrial carcinoma (EC) tissues, which suggested the degree of endometrial malignancy. PMID: 29767873
  3. The results identify HAND2 loci associated with susceptibility to early onset atrial fibrillation in a Korean population. PMID: 28460022
  4. These findings indicate that HAND2 loss-of-function mutation contributes to human CHD, perhaps via its interaction with GATA4 and NKX2.5. PMID: 26865696
  5. HAND2 and microRNA-1 facilitated the early progress of human induced cardiomyocyte-like cells reprogramming. PMID: 28796841
  6. this study is the first to report the association of a HAND2 loss-of-function mutation with an increased vulnerability to tetralogy of Fallot in humans, which provides novel insight into the molecular mechanism underpinning congenital heart disease PMID: 26676105
  7. HAND2-mediated proteolysis negatively regulates the function of estrogen receptor alpha. PMID: 26166202
  8. suggest that HAND2 plays a key role in the regulation of progestin-induced decidualization of human endometrial stromal cells. PMID: 24745730
  9. Reduced protein expression of HAND2 in the myenteric plexus of the aganglionic segment would suggest that HAND2 was involved in the pathogenesis of Hirschsprung disease. PMID: 24210200
  10. Increased HAND2 methylation was a feature of premalignant endometrial lesions and was seen to parallel a decrease in RNA and protein levels. PMID: 24265601
  11. Overdosage of Hand2 causes limb and heart defects in the human chromosomal disorder partial trisomy distal 4q. PMID: 23449628
  12. No evidence of linkage between HAND2 and CL/P was obtained. Levelss of exclusion were obtained with different inheritance models. results did not support HAND2 in CL/P PMID: 21431856
  13. Expression analyses on both Hand2 conditionally null and hypomorphic backgrounds demonstrate that Hand2 is required for reporter activation in a gene dosage-dependent manner during sympathetic neurogenesis. PMID: 22323723
  14. Data suggest Hand2 plays an important role in decidualization; expression of Hand2 is significantly increased in response to prostaglandin E2. PMID: 21527398
  15. These data suggest that cytokines can inhibit norepinephrine transporter expression through downregulation of Hand2 or Gata3 in cultured sympathetic neurons, but axotomy in adult animals selectively suppresses Hand2 expression. PMID: 21241805
  16. Hand2 performs an essential role during transgenic epicardialization, directly impacting epicardial cell differentiation and formation of the coronary vasculature. PMID: 21350214
  17. HAND2 may be a potential candidate gene of stenosis of the right ventricle, outflow tract. PMID: 20819618
  18. dHAND/E-protein (E2A, ME2, and ALF1) heterodimers have distinct DNA binding specificities PMID: 15351717
  19. These results demonstrate the direct interactions of the Phox2a and b and dHAND transcription factors within a noradrenergic cell type PMID: 16280598
  20. demonstrate evolutionarily conserved functions of HAND transcription factors in Drosophila and mammalian cardiogenesis, and reveal a previously unrecognized requirement of Hand genes in hematopoiesis PMID: 16467358
  21. Hand2 plays a pivotal role in regulating both cell-autonomous and -nonautonomous functions of the cardiac neural crest. PMID: 19008477
  22. Expression of HAND2 and DEIN genes in neuroblastoma is co-regulated by asymmetrical activity of this promoter and modulated by the activity of two cis-regulatory elements acting as weak repressors PMID: 19348682

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Heart.
Database Links

HGNC: 4808

OMIM: 602407

KEGG: hsa:9464

STRING: 9606.ENSP00000352565

UniGene: Hs.388245

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*