Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Heat shock protein 75 kDa; Heat shock protein 75 kDa, mitochondrial; HSP 75; HSP75; HSP90L; mitochondrial; TNF receptor associated protein 1; TNFR-associated protein 1; TRAP-1; Trap1; TRAP1_HUMAN; Tumor necrosis factor type 1 receptor-associated protein
Species
Homo sapiens (Human)
Expression Region
60-308aa
Target Protein Sequence
STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 60-308 form the expressed segment for recombinant Human TRAP1. The theoretical molecular weight of the TRAP1 protein is 54.5 kDa. This TRAP1 recombinant protein is manufactured in e.coli. The N-terminal GST tag was fused into the coding gene segment of TRAP1, making it easier to detect and purify the TRAP1 recombinant protein in the later stages of expression and purification.
The human heat shock protein 75 kDa, mitochondrial (TRAP1) is a molecular chaperone located in the mitochondria. TRAP1 belongs to the HSP90 family and plays a critical role in mitochondrial protein folding, stability, and cellular stress response. TRAP1 is involved in the regulation of mitochondrial functions, including energy production and apoptosis. As a chaperone, TRAP1 assists in the proper folding of mitochondrial proteins, maintaining mitochondrial homeostasis. Its role in cellular stress response makes TRAP1 a key player in protecting cells from various stressors, including oxidative stress. Research on TRAP1 explores its functions in mitochondrial biology, cellular stress adaptation, and its potential implications in diseases such as cancer, where mitochondrial dysfunction is often observed.