Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Delta-globin
Hemoglobin delta chain
Species
Homo sapiens (Human)
Expression Region
2-147aa
Target Protein Sequence
VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 2-147 constitute the expression domain of recombinant Human HBD. The calculated molecular weight for this HBD protein is 47.5 kDa. This HBD recombinant protein is manufactured in e.coli. The HBD gene fragment has been modified by fusing the N-terminal 6xHis-GST tag, providing convenience in detecting and purifying the recombinant HBD protein during the following stages.
The human hemoglobin subunit delta (HBD) is a protein that is part of the hemoglobin molecule, responsible for oxygen transport in red blood cells. HBD is located on chromosome 11. Hemoglobin is composed of four subunits – two alpha globin chains and two beta globin chains. The HBD expression is primarily restricted to the embryonic and fetal stages of development. In adults, the delta globin chain is replaced by the beta-globin chain. Hemoglobin containing the delta subunit is known as fetal hemoglobin (HbF). Understanding the regulation of hemoglobin subunit expression is crucial for comprehending normal hemoglobin function and disorders like thalassemias and sickle cell disease.
