Recombinant Human Hemoglobin subunit delta (HBD)

In Stock
Code CSB-EP010152HU
Abbreviation Recombinant Human HBD protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
Delta-globin Hemoglobin delta chain
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-147aa
Target Protein Sequence
VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 2-147 constitute the expression domain of recombinant Human HBD. The calculated molecular weight for this HBD protein is 47.5 kDa. This HBD recombinant protein is manufactured in e.coli. The HBD gene fragment has been modified by fusing the N-terminal 6xHis-GST tag, providing convenience in detecting and purifying the recombinant HBD protein during the following stages.

The human hemoglobin subunit delta (HBD) is a protein that is part of the hemoglobin molecule, responsible for oxygen transport in red blood cells. HBD is located on chromosome 11. Hemoglobin is composed of four subunits – two alpha globin chains and two beta globin chains. The HBD expression is primarily restricted to the embryonic and fetal stages of development. In adults, the delta globin chain is replaced by the beta-globin chain. Hemoglobin containing the delta subunit is known as fetal hemoglobin (HbF). Understanding the regulation of hemoglobin subunit expression is crucial for comprehending normal hemoglobin function and disorders like thalassemias and sickle cell disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in oxygen transport from the lung to the various peripheral tissues.
Gene References into Functions
  1. Blood donor homozygous for Hb D Los Angeles. PMID: 25217459
  2. The expression of the activated delta-globin gene in a beta-thalassemia mice model greatly improves the phenotype, validating the delta-globin chain as a therapeutic target for beta-hemoglobinopathies. PMID: 23872310
  3. Data indicate that a delta-globin mutation was suspected in both patients. PMID: 23806011
  4. Twenty-one different mutations were detected, and of these 12 have not been previously described. PMID: 23215833
  5. A functional promoter polymorphism of the delta-globin gene is a specific marker of the Arab-Indian haplotype PMID: 22641479
  6. This report describes a novel missense mutation in delta-globin (HBD: c.323G>A, Gly > Asp) in an Indian family with heterozygous beta-thalassemia with normal HbA(2) levels. PMID: 22477537
  7. The 5' breakapoint of the (deltabeta)(0) thalassemia deletion in a compound heterozygote was located in the second intron of the delta globin gene. PMID: 11860449
  8. Hb A2-Monreale [delta146(HC3)His-->Arg]is a novel delta chain variant. PMID: 11939506
  9. alternate mRNA species in adult erythroid cells; mRNA encodes an additional 145 nt in the upstream untranslated region, suggesting an alternative site of transcriptional initiation and transcription through the previously defined promoter PMID: 15234005
  10. The atomic coordinates of the delta-chain of hemoglobin A2 (R2 state) are used to model the structure of hemoglobin homotetramer delta 4, which occurs in rare hemoglobin H disease. PMID: 15449937
  11. Deletion pf this geneis a common, and possibly the predominant beta-thalassemia mutation of the Austroasiatic Lao Theung population. PMID: 15757827
  12. characterization of the delta-globin gene alleles and of RFLP-haplotypes, SNPs and one microsatellite associated with them in 231 carriers originating principally from East Sicily; Seventeen alleles were identified, of which five were new PMID: 18221842
  13. Borderline HbA(2) is not a rare event in a population with a high prevalence of beta-thalassemia carriers PMID: 18603555
  14. Unusually low levels of HBA2 in a compound heterozygote can be explained from the functional inhibition of the HBD gene, in cis to the HBG1 gene, bearing the nd-HPFH mutation. PMID: 18615450
  15. Hb A2 IVS-I-5 (G > C) beta-thalassemia mutation phenotype in 289 carriers was reported. PMID: 18932068

Show More

Hide All

Protein Families
Globin family
Tissue Specificity
Red blood cells.
Database Links

HGNC: 4829

OMIM: 142000

KEGG: hsa:3045

STRING: 9606.ENSP00000369654

UniGene: Hs.699280

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*