Code | CSB-EP010156HU |
MSDS | |
Size | US$306 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Do you have them: HBG2 ?
I am looking for the control protein for HbH (β4) and Barts (γ4) · I am studying the haemoglobin variants and I couldn't able to find these two controls for my study. The closest protein I found is HBG1.HBG2 for barts and HBB for HbH. However, I am not sure whether this is the right protein to choose.
GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH