Recombinant Human Hemoglobin subunit gamma-2(HBG2)

Code CSB-EP010156HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P69892
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Research Area Cardiovascular
Source E.coli
Gene Names HBG2
Protein Names Recommended name: Hemoglobin subunit gamma-2 Alternative name(s): Gamma-2-globin Hb F Ggamma Hemoglobin gamma-2 chain Hemoglobin gamma-G chain
Expression Region 2-147aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 23.0 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
Involvement in disease Cyanosis transient neonatal (TNCY)
Protein Families Globin family
Tissue Specificity Red blood cells.
Database Links

HGNC: 4832

OMIM: 142250

KEGG: hsa:3048

STRING: 9606.ENSP00000338082

UniGene: Hs.302145

Q&A and Customer Reviews

Q&A
Q:

Do you have them: HBG2 ?
I am looking for the control protein for HbH (β4) and Barts (γ4) · I am studying the haemoglobin variants and I couldn't able to find these two controls for my study. The closest protein I found is HBG1.HBG2 for barts and HBB for HbH. However, I am not sure whether this is the right protein to choose.

A:
Very nice to receive your inquiry. Recombinant Human Hemoglobin subunit gamma-2(HBG2)
CSB-YP010156HU >> Yeast
CSB-EP010156HU >> E.coli CSB-BP010156HU >> Baculovirus
CSB-MP010156HU >> Mammalian
Expression Region: 2-147aa; Full length of the mature protein.
Tag information:EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged; YP: N-terminal 6xHis-tagged
Sequence:

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH


Customer Reviews

Related Products

HBG2 Antibodies

HBG2 Antibodies for Homo sapiens (Human)

HBG2 Antibodies for Human

HBG2 Proteins

HBG2 Proteins for Homo sapiens (Human)

HBG2 ELISA Kit

HBG2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.