Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

HBG2

Uniprot No.

P69892

Research Area

Cardiovascular

Alternative Names

Abnormal hemoglobin; FLJ76540; G gamma globin; Gamma 2 globin; Gamma-2-globin; Hb F Ggamma; HBG 2; HBG2; HBG2_HUMAN; Hemoglobin gamma 2 chain; Hemoglobin gamma G; Hemoglobin gamma G chain; Hemoglobin gamma-2 chain; Hemoglobin gamma-G chain; Hemoglobin subunit gamma 2; Hemoglobin subunit gamma-2; Methemoglobin; OTTHUMP00000069638

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-147aa

Target Protein Sequence

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This premium-grade Recombinant Human HBG2 is a powerful tool for researchers in the cardiovascular field. Hemoglobin subunit gamma-2, also known as gamma-2-globin, plays a crucial role in fetal oxygen transport during early development. Our recombinant protein is designed to support your experimental endeavors with exceptional performance and reliability.

Recombinant Human HBG2 is expressed in E.coli, featuring the full length of the mature protein covering the expression region from 2-147 amino acids. The protein is N-terminal 6xHis-tagged and C-terminal Myc-tagged, facilitating straightforward purification and detection protocols. With a purity greater than 85% as determined by SDS-PAGE, this reagent ensures consistent performance and high quality for your research applications. Available in both liquid and lyophilized powder forms, Recombinant Human HBG2 is designed to accommodate your specific research requirements.

Target Background

Function

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Gene References into Functions

The results suggested that there was a significant relationship between high fetal hemoglobin levels and two variations (-309A/T and -369C/G) in Ggamma gene promotor. PMID: 29412791
Genetic association studies provide a rationale for functional studies of HBG2 expression in wild-type and T/A/T haplotype erythroblasts and mechanistic studies like chromatin conformation capture experiments, to evaluate the role of chromatin looping as a mediator of the T/A/T haplotype effects on HbF. PMID: 27185208
The frequency of rs7482144 was determined in Colombian sickle cell anemia patients. It indicated a West African ethnic background. PMID: 26849705
In Portuguese beta-thalassemia carriers the HBG2 XmnI polymorphism is strongly associated with HbF levels. PMID: 25842369
DNA polymorphisms at BCL11A, HBS1L-MYB and Xmn1-HBG2 site loci associated with fetal hemoglobin levels in sickle cell anemia patients from Northern Brazil. PMID: 25084696
Its polymorphism effects HbF, HbE, MCV and MCH levels in Thai HbE carriers. PMID: 24474642
Data indicate that the T to A conversion results in a leucine to histidine amino acid change at codon 105 of the (G)gamma-globin HBG2 gene and caused a hemoglobin (Hb) variant with lowered oxygen affinity. PMID: 24502349
Hemoglobin gamma G plays a role in modifying clinical symptoms of beta-thalassemia innorthern Thailand. PMID: 25123009
Hb F is regulated in inherited bone marrow failure syndromes by Xmn1-HBG2, as it is in the haemoglobinopathies. PMID: 23713742
Our data suggest that a temporal repression mechanism is operative in the silencing of gamma-globin gene expression PMID: 23284307
the study demonstrated that Egyptian beta-thalessemia patients have low frequency of positivity for the Xmnl polymorphism whether in heterozygous (+/-) or homozygous (+/+) state PMID: 22871617
although the prevalence of Xmn1-(G)gamma polymorphism is high in beta thalassemia intermedia patients, it alone could not predict clinical severity of disease PMID: 21755589
Chromatin looping between the Ggamma-globin gene and LCR HSs requires NF-E2. PMID: 21609963
We identified a missense mutation in the fetal Ggamma-globin gene (HBG2) in a father and daughter with transient neonatal cyanosis and anemia. PMID: 21561349
12 molecules in the unit cell describe a right-handed helical filament having no polarity, which is different from the filament composed of HbS fibers, which is the only other well characterized fiber of human hemoglobin PMID: 21123872
The polymorphisms -396_-391 del HBG2, -369 SNP HBG2 and -271 SNP HBG1 correlated with HbF levels, hence, it suggests an important role of HBG2 and HBG1 gene polymorphisms on the HbF synthesis. PMID: 20602015
The recently identified chromatin factor Friend of Prmt1 (FOP) is a critical modulator of gamma-globin gene expression. PMID: 20688955
A G>C substitution at position 479 of the (G)gamma-globin gene results in a glutamic acid to glutamine substitution at codon 101 of the (G)gamma-globin chain, a new gamma chain variant that we have named Hb F-Zhejiang PMID: 20113294
Data suggest the G gamma-globin promoter is activated by cJun via an upstream cAMP response element. PMID: 19861239
No statistically significant difference in the frequency of positive XmnI(G)gamma polymorphism was observed between thalassemia intermedia and thalassemia major patients. PMID: 19892574
Data show that (G)Gamma-158(C-->T) had a strong association with moderately increased Hb F levels in beta-thalassemia heterozygotes in the Guangxi area of China. PMID: 15476181
3' flank of the Ggamma-globin gene contains multiple weak pause elements which, combined with the strong polyA signal the gene possesses, are likely to cause gradual termination across the 3' flank. PMID: 15798211
A determinant linked to the XmnI restriction site which effects Ggamma-globin gene expression (and Hemoglobin F production) is active in beta-Thalassemic (anemic) adults but not in normal infants. PMID: 17365007
analysis of heme uptake from human methemoglobin by the iron-regulated surface determinants system of Staphylococcus aureus PMID: 18467329
HBG2:g-109G>T mutation has a functional role in increasing HBG2 transcription and is responsible for the hereditary persistence of fetal hemoglobin phenotype observed in our index cases PMID: 19050890

Hide All

Involvement in disease

Cyanosis transient neonatal (TNCY)

Protein Families

Globin family

Tissue Specificity

Red blood cells.

Database Links

HGNC: 4832

OMIM: 142250

KEGG: hsa:3048

STRING: 9606.ENSP00000338082

UniGene: Hs.302145

Code	CSB-EP010156HUa1
Abbreviation	Recombinant Human HBG2 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP010156HUa1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HBG2. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP010156HUa1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HBG2. (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Hemoglobin subunit gamma-2 (HBG2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage