Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Abnormal hemoglobin; FLJ76540; G gamma globin; Gamma 2 globin; Gamma-2-globin; Hb F Ggamma; HBG 2; HBG2; HBG2_HUMAN; Hemoglobin gamma 2 chain; Hemoglobin gamma G; Hemoglobin gamma G chain; Hemoglobin gamma-2 chain; Hemoglobin gamma-G chain; Hemoglobin subunit gamma 2; Hemoglobin subunit gamma-2; Methemoglobin; OTTHUMP00000069638
Species
Homo sapiens (Human)
Expression Region
2-147aa
Target Protein Sequence
GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This premium-grade Recombinant Human HBG2 is a powerful tool for researchers in the cardiovascular field. Hemoglobin subunit gamma-2, also known as gamma-2-globin, plays a crucial role in fetal oxygen transport during early development. Our recombinant protein is designed to support your experimental endeavors with exceptional performance and reliability.
Recombinant Human HBG2 is expressed in E.coli, featuring the full length of the mature protein covering the expression region from 2-147 amino acids. The protein is N-terminal 6xHis-tagged and C-terminal Myc-tagged, facilitating straightforward purification and detection protocols. With a purity greater than 85% as determined by SDS-PAGE, this reagent ensures consistent performance and high quality for your research applications. Available in both liquid and lyophilized powder forms, Recombinant Human HBG2 is designed to accommodate your specific research requirements.