Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
dJ221C16.10.1; Hemochromatosis; Hemochromatosis protein; Hereditary hemochromatosis protein; Hereditary hemochromatosis protein HLA H; HFE 1; HFE; HFE_HUMAN; HFE1; HH; High Fe; HLA H; HLA-H; HLAH; MGC:150812; MGC10379; MGC103790; MHC class I like protein HFE; MVCD7; TFQTL2
Species
Homo sapiens (Human)
Expression Region
23-306aa
Target Protein Sequence
RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 23-306 constitute the expression domain of recombinant Human HFE. The calculated molecular weight for this HFE protein is 40.2 kDa. The HFE protein was expressed in e.coli. Fusion of the N-terminal 10xHis tag and C-terminal Myc tag into the HFE encoding gene fragment was conducted, allowing for easier detection and purification of the HFE protein in subsequent stages.
The human hereditary hemochromatosis protein (HFE) is essential for iron homeostasis regulation. HFE interacts with the transferrin receptor, influencing cellular iron uptake. Mutations in HFE are associated with hereditary hemochromatosis, a disorder characterized by excessive iron absorption. In hematology, HFE research contributes to understanding iron metabolism and hemochromatosis pathogenesis. Additionally, HFE's role in modulating immune responses suggests implications in autoimmune diseases. In genetics, studying HFE variants aids in population genetics and disease risk assessment. Investigating HFE provides insights into iron-related disorders, immune function, and genetic susceptibility, offering potential applications in therapeutic strategies targeting iron dysregulation and genetic screening for hemochromatosis risk.
