Recombinant Human Histamine N-methyltransferase (HNMT)

In Stock
Code CSB-EP010598HU
Abbreviation Recombinant Human HNMT protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HNMT
Uniprot No.
Research Area
Cardiovascular
Alternative Names
HMT;HNMT
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-292aa
Target Protein Sequence
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.
Gene References into Functions
  1. Histamine N-methyltransferase plays a central role in the degradation of the neurotransmitter histamine. Leucine 208 is a critical amino acid residue to maintain the structural integrity of the protein. Replacements by other amino acid residues have profound effects on stability and catalytic activity. PMID: 27769936
  2. NHMT polymorphisms are not associated with Parkinson's disease, ALS and multiple system atrophy in Chinese population. PMID: 29564728
  3. miR-223 participates in the pathogenesis of atopic dermatitis through upregulating HNMT indirectly to degrade the excessive histamine. PMID: 29506638
  4. The C allele for the HNMT polymorphism was associated with a lower degree of disability due to migraine (OR, 10.0; 95% CI, 2.65-37.6). In contrast, presence of the T allele (in heterozygous individuals) was associated with higher degree of disability (OR, 37.1; 95% CI, 4.37-315.2) PMID: 27130307
  5. This study shown that eight linked SNPs (r(2) = 1) in the HNMT gene were associated with sedation according to the generalized linear model, adjusted for age, gender and BMI (false-discovery-rate-adjusted p = 0.013). PMID: 28400155
  6. Genotype and allelic variant frequencies of HNMT rs11558538 SNP 205 restless legs syndrome (RLS) patients and 410 controls using a TaqMan assay: HNMT rs11558538 genotypes allelic variants frequencies were similar between RLS patients and controls and not influenced by gender, family history of RLS, or RLS severity. Some evidence that RLS patients carrying the genotype rs11558538TT had an earlier age at onset. PMID: 27837280
  7. The present meta-analysis confirms published evidence suggesting that the HNMT rs11558538 minor allele is related to a reduced risk of developing Parkinson disease PMID: 27399132
  8. this study shows that single nucleotide polymorphism is associated with the severity of allergic rhinitis in a group of Mexican children PMID: 27255477
  9. The T allele of rs3787429 exhibited protective effect against CHF under the dominant and additive models , while, for SNPs in HRH2, DAO, and HNMT, no significant associations were observed in the present study PMID: 26989676
  10. HNMT is identified as a novel gene responsible for intellectual disability. The consequences of the identified missense mutations on the protein function are discussed. PMID: 26206890
  11. HRH1-17 TT and HNMT-1639 TT genotypes were associated with the allergic asthma phenotype among African-American children and that the ABP 4107 GG genotype was associated with nonallergic asthma among white children. PMID: 25909280
  12. results suggest that the heterozygous Thr/Ile genotype at the HNMT-Thr105Ile locus and the minor Ile105 allele protect against Parkinson's disease and schizophrenia in Han Chinese. PMID: 25768024
  13. The polymorphisms of HNMT and HRH3 were irrelevant with breast cancer in the present study. PMID: 24835231
  14. The A939G HNMT polymorphism is associated with autoimmune MG, while no association with C314T SNP was found. PMID: 23932992
  15. The results of this study indicated that Histamine N-methyltransferase Thr105Ile polymorphism is associated Parkinson's disease. PMID: 21794955
  16. Lack of the association of HNMT Thr105Ile functional polymorphism with Alzheimer's disease is found. PMID: 21138759
  17. our results suggest that, despite the possible role of histamine in the inflammatory processes related with the pathogenesis of MS, HNMT polymorphism is not related with the risk for MS in Caucasian Spanish people PMID: 19538200
  18. This study do not support the HNMT Thr105Ile variant as a factor in disease development or a genetic link between the disorders. PMID: 19773194
  19. identification of several novel HNMT polymorphisms, identification of the HNMT core promoter PMID: 12167489
  20. for the histamine N-methyltransferase gene no differences in allele distribution were found in patients with food allergy and sprue compared to controls except for the 314t allele PMID: 12755416
  21. Single nucleotide polymorphisms were identified in HNMT in Chinese and their relationship assessed with its activity. PMID: 12835614
  22. the C314T polymorphism was functionally important and contributes in part to phenotypic variance of histamine N-methyltransferase activity in Chinese Han population PMID: 12867290
  23. Studies showed a new brain HNMT mRNA species, named HNMT-Short (HNMT-S), which encodes a 126-amino-acid protein. PMID: 14667820
  24. no evidence for the involvement of HNMT polymorphisms in the susceptibility to gastric ulcer PMID: 15551002
  25. Polymorphisms and haplotypes in the the HNMT gene are not associated with asthma in the Indian population. PMID: 16205835
  26. An association of the HNMT Thr105Ile polymorphism, but not of the ABP1 His645Asp polymorphism, with PD was observed. Patients with PD showed a higher frequency of homozygous HNMT genotypes PMID: 17985251
  27. No association can be found in the involvement of HNMT C314T polymorphism in the susceptibility to duodenal ulcer PMID: 18086566
  28. Molecular dynamics simulations indicate that the histamine N-methyltransferase T105I polymorphism affects both active site structure and dynamics. PMID: 18154359
  29. histamine N-methyltransferase is not related with the risk for migraine. PMID: 18266724
  30. These results, combined with previous findings indicating alterations in the frequency for the HNMT Thr105Ile polymorphism in patients with PD, suggest that alterations of histamine homeostasis in the SNC are associated with risk of movement disorders. PMID: 18543121
  31. Increased histamine levels in patients with atopic dermatitis may result, at least in part, from reduced enzymatic inactivation via HNMT. PMID: 19025430
  32. The HNMT 939A>G polymorphism lowers HNMT enzymatic activity by decreasing HNMT mRNA stability, which leads to an increase in the histamine level and contributes to the development of aspirin intolerant chronic urticaria. PMID: 19178400

Show More

Hide All

Involvement in disease
Mental retardation, autosomal recessive 51 (MRT51)
Subcellular Location
Cytoplasm.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, HNMT family
Database Links

HGNC: 5028

OMIM: 605238

KEGG: hsa:3176

STRING: 9606.ENSP00000280097

UniGene: Hs.42151

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*