Recombinant Human Homeobox protein Hox-A10 (HOXA10)

Code CSB-YP010648HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP010648HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP010648HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP010648HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP010648HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
HOXA10
Uniprot No.
Alternative Names
Centaurin alpha 1 like ; Homeo box A10 ; Homeobox A10; Homeobox protein 1H ; Homeobox protein Hox A10; Homeobox protein Hox-1.8; Homeobox protein Hox-1H; Homeobox protein Hox-A10; Homeobox protein HOXA10 ; HOX 1; HOX 1.8; HOX 1H; HOX A10; HOX1; HOX1.8; HOX1H ; HOXA 10; HOXA10; HOXA10 protein; HXA10_HUMAN; MGC12859; PL
Species
Homo sapiens (Human)
Expression Region
1-94
Target Protein Sequence
MCQGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLT DRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Protein Length
full length protein of Isoform 2
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
Gene References into Functions
  1. HOXA10 protein and mRNA were decreased in ovarian endometriomas compared with eutopic endometria of women with endometriosis and normal endometria. Moreover, HOXA10 was found to have a significant negative correlation with autophagy. PMID: 29658437
  2. Study addressed HOXA10-AS as a regulator of cell proliferation and apoptosis in glioma, and identified HOXA10 as a target of HOXA10-AS. Additionally, the oncogene HOXA10 had an important role in promoting the tumorigenesis of glioma. PMID: 30132568
  3. the present study demonstrated that miR135a serves as a tumor suppressor in AML by targeting HOXA10, and miR135a may be a promising prognostic biomarker for AML patients. PMID: 29845297
  4. Significant HOXA10 overexpression in CRC may be a potential biomarker indicating poor prognosis and 5-FU resistance PMID: 29870276
  5. Results show that the inhibition of HOXA10 in DAOY cell line led to increased in vitro cell migration while in vitro cell proliferation or in vivo tumorigenic potential were unaffected. This suggests that HOXA10 plays a role in migration events. PMID: 29039487
  6. We conclude that the expression patterns of HoxA10, HoxA11, and HoxA13 and their actions in regulating CAP genes in the uterus create regionalized myometrium phenotypes in women that may be important to control regionalized myometrium contractility for maintaining pregnancy. PMID: 28372536
  7. These results suggest that downregulation of HOXA10 in the decidual cells promotes the expression of a cascade in the trophoblast cells, leading to an increase in matrix metalloproteinases to facilitate invasion. PMID: 28520923
  8. Endometrial expression of HOXA10 and E-cadherin are reduced in women with recurrent implantation failure and recurrent miscarriage. PMID: 27793380
  9. Reduced expression of HOXA10 is associated with Hydrosalpinx. PMID: 26840046
  10. To summarize, significant differential methylation of HOXA10 and COMT promoter regions was found between the ectopic and eutopic endometrial tissues. This is the first study investigating the methylation of HOXA10 and COMT genes and their linkage to endometriosis in Chinese patients. PMID: 28074437
  11. using both knockdown and knockout approaches we show that Hottip expression is required for activation of the 5' Hoxa genes (Hoxa13 and Hoxa10/11) and for retaining Mll1 at the 5' end of Hoxa. Moreover, we demonstrate that artificially inducing Hottip expression is sufficient to activate the 5' Hoxa genes and that Hottip RNA binds to the 5' end of Hoxa PMID: 28384324
  12. HOXA10 is overexpressed in oral squamous cell carcinoma (OSCC) and its expression is functionally associated with several important biological processes related to oral tumorigenesis, such as proliferation, migration and invasion. PMID: 26097543
  13. The results demonstrated that mutation in HOXA10 gene contributes to the pathogenesis of cryptorchidism, but may not be a common cause. PMID: 27108669
  14. The HOXA10 gene in women with endometriosis was hypomethylated compared to controls. PMID: 26865543
  15. HOXA10 was expressed at a high level in the K562/ADM cells, and knockdown of HOXA10 enhances the sensitivity of the K562/ADM cells to cytotoxic killing by the therapeutic drug, ADR, as a result of the increased intracellular accumulation of ADR. PMID: 27035504
  16. Regulated HOXA10 and HOXA11 expression is necessary for endometrial receptivity; decreased HOXA10 or HOXA11 expression leads to decreased implantation rates. Alternation of HOXA10 and HOXA11 expression has been identified as a mechanism of the decreased implantation associated with endometriosis, polycystic ovarian syndrome, leiomyoma, polyps, adenomyosis, and hydrosalpinx. PMID: 26552702
  17. The combinatory expression of HOXA10 and CD44 was correlated with poor gastric cancer prognosis. PMID: 26552644
  18. confirmed that HOXA10 promoted epithelialmesenchymal transition in ovarian cancer cells PMID: 26151663
  19. Promoter activity of HOXA10 lies in 5.3-6.1 kb upstream of protein coding region.CTCF negatively regulates HOXA10 expression in breast cancer cells.CTCF flanks important promoter element of HOXA10. PMID: 26478432
  20. The results showed overexpression of HOXA10 mRNA and protein in Ishikawa cell. PMID: 25757424
  21. HOXA10 is expressed in rectosigmoid endometriosis, where it likely imparts the de novo identity of endometriotic lesions. PMID: 25217304
  22. miR-494 repressed the expression of HOXA10 and also reduced the proliferation of oral cancer cells. These data give more evidence of the role of miR-494 as a tumor suppressor miRNA in oral cancer. PMID: 25500095
  23. Peri-implantation HOXA-10 mRNA expression is increased following laparoscopic endometrioma resection. PMID: 26056923
  24. the CpG island of the HOXA10 alternative promoter appears to escape hypermethylation in the HOX-high glioblastoma. PMID: 25622821
  25. Data show that recruitment of MLL1 (mixed lineage leukaemia histone methylase 1) to the homeobox-containing gene HOXA10 EREs (estrogen response elements) is mediated via ERalpha (estrogen receptor alpha). PMID: 25307539
  26. Expression of HOXA10 and p21 gene decreased in endometrial cancer, and the expression level of HOXA10 was correlated with cancer grade. PMID: 24943991
  27. regulatory mechanism of HoxA10 in prostate cancer PMID: 24951955
  28. The regulatory mechanism of miR-218 in human hepatocellular carcinoma cells was acting through PTEN/AKT/PI3K pathway and possibly associated with HoxA10. PMID: 25120782
  29. The HOXA10 gene is more methylated in the eutopic endometrium of patients with endometriosis. PMID: 24963168
  30. Inhibition of HOXA10 expression with miR-135a mimics and HOXA10 siRNA resulted in cell apoptosis with concomitant enhancement of caspase-3, increase of p53 expression and reduction of Bcl-2 expression, and also suppressed cell growth and adhesion. PMID: 24607788
  31. this study demonstrated that an increased HOXA10 expression in human ovarian cancer is a result of the co-activation of HOXA10 gene promoter's hypomethylation and the binding of transcription factor WT1. PMID: 23888944
  32. these results suggested that the miR-135a-VLDLR-p38 axis may contribute to gallbladder cancer cell proliferation PMID: 24903309
  33. HOXA10 promotes cell invasion and MMP-3 expression of pancreatic cancer cells via TGFbeta2-p38 MAPK pathway. PMID: 24464212
  34. Lower expression of HOXA10 is associated with endometriosis-associated infertility. PMID: 23979130
  35. Endometrial cancer tissue displays significantly higher methylation status in HOXA10 gene promoter than normal tissue. PMID: 23815210
  36. The level of HOXA10 decreases in the eutopic endometrium of patients with endometriosis. PMID: 22915150
  37. These results demonstrate that the HOXA10-mediated expression of MMP-26 promotes embryo adhesion during the process of embryonic implantation. PMID: 24565841
  38. Co-activation of miR-196b and HOXA10 characterized a poor-prognosis subgroup of patients with gastric cancer. PMID: 24222951
  39. HOXA10-PCAF association impairs embryo implantation by inhibiting ITGB3 protein expression in endometrial epithelial cells. PMID: 24037888
  40. This study documented significantly higher HOXA10 promoter methylation levels in women with ovarian endometriomas than in healthy controls during the mid-luteal phase. PMID: 24032603
  41. HOXA10 has been found to be methylated in all hereditary breast cancer patients analyzed but never in healthy subjects. PMID: 23051705
  42. There are complex etiopathogenic mechanisms for endometriosis between INFG and HOXA10. PMID: 23412855
  43. Rare DNA sequence variations in the HOXA10 gene could contribute to the misdevelopment of female internal genitalia. PMID: 23376215
  44. Compared with the negative control and untreated groups, mRNA level of HOXA10 decreased by (92.3+/-1.3)%, protein levels decreased by 91.1%, and the inhibition rate of U937 cells [(43.9+/-0.7)%] increased in the interference group PMID: 23092574
  45. We found that MLL directly activates the Homeobox gene HOXA10 in human glioblastoma PMID: 23108137
  46. a molecular mechanisms through which increased expression of HoxA10 increases Cdx4 expression by direct CDX4 activation and by Fgf2-induced beta-catenin activity. This results in Cdx4-induced HoxA10-expression, creating a positive feedback mechanism PMID: 23038246
  47. found that increased Fgf2 production by HoxA10-overexpressing myeloid progenitor cells induced a phosphoinositol 3-kinase-dependent increase in beta-catenin protein PMID: 22493287
  48. HOXA10 expression was associated with GC with the intestinal mucin phenotype. PMID: 22411957
  49. regulates FKBP4 during decidualization PMID: 22279148
  50. mutation of HOXA10 gene may contribute to the development of Mullerian duct anomalies; it is an important transcription factor in reproductive tract development PMID: 21900391

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Abd-B homeobox family
Database Links

HGNC: 5100

OMIM: 142957

KEGG: hsa:3206

STRING: 9606.ENSP00000283921

UniGene: Hs.110637

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1