Recombinant Human Immunoglobulin-like domain-containing receptor 2(ILDR2),partial

Code CSB-YP751251HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. Q71H61
Abbreviation ILDR2
Relevance May be involved in lipid homeostasis and ER stress pathways.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE
Research Area Immunology
Source Yeast
Gene Names ILDR2
Protein Names Recommended name: Immunoglobulin-like domain-containing receptor 2
Expression Region 1-186aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in lipid homeostasis and ER stress pathways.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, LISCH7 family
Database Links

HGNC: 18131

KEGG: hsa:387597

UniGene: Hs.444835

Related Products

ILDR2 Antibodies

ILDR2 Antibodies for Homo sapiens (Human)

ILDR2 Proteins

ILDR2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.