Home
Protein
Recombinant Proteins
Recombinant Human Integrin beta-like protein 1 (ITGBL1)

Recombinant Human Integrin beta-like protein 1 (ITGBL1)

^{In Stock}

Code	CSB-EP011893HU
Abbreviation	Recombinant Human ITGBL1 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ITGBL1

Uniprot No.

O95965

Research Area

Others

Alternative Names

ITGBL1; OSCP; TIED; Integrin beta-like protein 1; Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

24-494aa

Target Protein Sequence

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

58.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

A cDNA sequence coding for integrin beta-like protein 1 (ITGBL1) was inserted a 10xHis-tag at the N-terminus ＆ a Myc-tag at the C-terminus and then expressed in E.coli. The product is a full-length of mature protein consisting of 24-494AA of human ITGBL1. It has a calculated molecular weight of 58.9 kDa. And it got over 90% in purity determined by SDS-PAGE. This recombinant ITGBL1 protein is in-stock now.

ITGBL1 is a β-integrin-related extracellular matrix (ECM) protein and involved in the development and metastasis of many tumors. Studies showed that ITGBL1 could promote bone metastasis of breast cancer through the TGF-β signaling pathway. It also stimulated the invasion of ovarian cancer cells via Wnt/planar cell polarity (PCP) signaling and focal adhesion kinase (FAK)/Src pathway. High expression of ITGBL1 was related to the poor prognosis and drug resistance of ovarian cancer.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions

Characterization of gene expression profiles in hepatitis B-related liver fibrosis patients identified ITGBL1 and its interactions with TGFB1 as key regulators of fibrogenesis. PMID: 28262670
ITGBL1 was associated with cell adhesion. PMID: 29772438
our results suggest that ITGBL1 is a novel tumor suppressor in non-small cell lung cancer progression. PMID: 26307393
ITGBL1 might be a novel biomarker for ovarian cancer diagnosis. PMID: 27261588
Data indicate the transforming growth factor beta (TGFbeta) signaling pathway as a downstream effector of integrin beta-like 1 (ITGBL1) and the transcription factor Runx2 as an upstream activator of ITGBL1 expression. PMID: 26060017

Hide All

Subcellular Location

Secreted.

Tissue Specificity

Widely expressed in many tissues, but readily detectable only in aorta.

Database Links

HGNC: 6164

OMIM: 604234

KEGG: hsa:9358

STRING: 9606.ENSP00000365351

UniGene: Hs.696554

Promotions