Recombinant Human Integrin beta-like protein 1 (ITGBL1)

Discontinued
Code CSB-MP011893HU
Abbreviation Recombinant Human ITGBL1 protein
MSDS
Size $660
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Osteoblast-specific cysteine-rich protein (Ten integrin EGF-like repeat domain-containing protein)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-494aa
Target Protein Sequence
VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-28 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Integrin beta-like protein 1 (ITGBL1) is produced using a mammalian expression system, which appears to ensure proper protein folding and post-translational modifications. The full-length mature protein spans amino acids 24 to 494. It comes with an N-terminal 10xHis tag and a C-terminal Myc tag - features that make purification and detection more straightforward. SDS-PAGE analysis shows the protein reaches greater than 85% purity, a level that seems adequate for most research applications.

ITGBL1 belongs to the integrin family, proteins known for their crucial roles in cell adhesion and signaling. Interestingly though, ITGBL1 itself doesn't bind ligands the way typical integrins do. Instead, it likely modulates cellular interactions and signaling pathways through other mechanisms. Researchers have found it relevant to studies of cell migration and tissue organization, and there may be novel roles in cellular communication yet to be discovered.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant human ITGBL1 protein are unknown and cannot be assumed. Although the ITGBL1 protein is expressed in a mammalian system, which is more likely to support proper folding and post-translational modifications compared to prokaryotic systems, the presence of both N-terminal and C-terminal tags (10xHis and Myc) may still interfere with the native structure or function. The activity has not been validated, so it is uncertain whether the protein is correctly folded or bioactive. Therefore, applications that rely on specific biological activity or native conformation must be considered speculative without experimental confirmation.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 10xHis tag allows for immobilization on nickel-based matrices for pull-down experiments to identify potential binding partners. However, since the protein's folding and activity are unverified, any interactions detected may be non-specific or artifacts if the protein is misfolded. The dual tags provide flexibility for validation, but results should be interpreted with caution and confirmed using orthogonal methods, such as co-immunoprecipitation with endogenous protein, to ensure biological relevance.

2. Antibody Development and Validation

This recombinant ITGBL1 protein is suitable as an immunogen for generating polyclonal or monoclonal antibodies. The mammalian expression system may produce proteins with folding and modifications similar to the native form, potentially increasing the likelihood of antibodies with physiological relevance. However, antibody specificity must be rigorously validated against native ITGBL1 in human tissues or cell lines, as antibodies may primarily recognize linear epitopes or the tags rather than conformational epitopes of the native protein. The Myc tag can serve as a positive control for expression and loading.

3. ELISA-Based Quantitative Assays

The dual-tagged ITGBL1 protein can be used to develop sandwich ELISA assays for research purposes. However, the assay's ability to accurately quantify native ITGBL1 in biological samples (e.g., cell culture supernatants or tissue extracts) is uncertain without validation against a native standard. The ELISA may be reliable for detecting the recombinant ITGBL1 protein itself, but it may not correlate with endogenous ITGBL1 levels due to potential differences in folding, modification, or tag interference. Assay development should include validation with native samples to ensure specificity.

4. Biochemical Characterization and Stability Studies

This recombinant ITGBL1 protein is well-suited for biochemical characterization, including thermal stability, pH sensitivity, and buffer optimization studies. Techniques like dynamic light scattering, circular dichroism, and analytical ultracentrifugation can provide insights into the protein's biophysical properties. This application is valid as it focuses on intrinsic properties of the recombinant protein and does not require native bioactivity. However, the results may not fully represent the native ITGBL1 due to the presence of tags, so conclusions should be drawn cautiously.

Final Recommendation & Action Plan

The immediate priority is to validate the recombinant ITGBL1 protein's folding and bioactivity before proceeding with functional studies. This can be done using techniques such as circular dichroism to assess secondary structure, size-exclusion chromatography to monitor oligomerization, and functional assays (e.g., binding assays with known partners if available) to confirm activity. Once activity is verified, the protein can be reliably used for interaction studies, antibody development, and ELISA applications. If activity is not confirmed, the protein should be limited to biochemical characterization and as a tool for generating antibodies, with the understanding that they may not recognize native ITGBL1. Always include appropriate controls and validation steps in experiments to ensure data reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Characterization of gene expression profiles in hepatitis B-related liver fibrosis patients identified ITGBL1 and its interactions with TGFB1 as key regulators of fibrogenesis. PMID: 28262670
  2. ITGBL1 was associated with cell adhesion. PMID: 29772438
  3. our results suggest that ITGBL1 is a novel tumor suppressor in non-small cell lung cancer progression. PMID: 26307393
  4. ITGBL1 might be a novel biomarker for ovarian cancer diagnosis. PMID: 27261588
  5. Data indicate the transforming growth factor beta (TGFbeta) signaling pathway as a downstream effector of integrin beta-like 1 (ITGBL1) and the transcription factor Runx2 as an upstream activator of ITGBL1 expression. PMID: 26060017

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Widely expressed in many tissues, but readily detectable only in aorta.
Database Links

HGNC: 6164

OMIM: 604234

KEGG: hsa:9358

STRING: 9606.ENSP00000365351

UniGene: Hs.696554

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*