Recombinant Human Integrin beta-like protein 1 (ITGBL1)

In Stock
Code CSB-EP011893HU
Abbreviation Recombinant Human ITGBL1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ITGBL1
Uniprot No.
Research Area
Others
Alternative Names
ITGBL1; OSCP; TIED; Integrin beta-like protein 1; Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-494aa
Target Protein Sequence
VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

A cDNA sequence coding for integrin beta-like protein 1 (ITGBL1) was inserted a 10xHis-tag at the N-terminus & a Myc-tag at the C-terminus and then expressed in E.coli. The product is a full-length of mature protein consisting of 24-494AA of human ITGBL1. It has a calculated molecular weight of 58.9 kDa. And it got over 90% in purity determined by SDS-PAGE. This recombinant ITGBL1 protein is in-stock now.

ITGBL1 is a β-integrin-related extracellular matrix (ECM) protein and involved in the development and metastasis of many tumors. Studies showed that ITGBL1 could promote bone metastasis of breast cancer through the TGF-β signaling pathway. It also stimulated the invasion of ovarian cancer cells via Wnt/planar cell polarity (PCP) signaling and focal adhesion kinase (FAK)/Src pathway. High expression of ITGBL1 was related to the poor prognosis and drug resistance of ovarian cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Characterization of gene expression profiles in hepatitis B-related liver fibrosis patients identified ITGBL1 and its interactions with TGFB1 as key regulators of fibrogenesis. PMID: 28262670
  2. ITGBL1 was associated with cell adhesion. PMID: 29772438
  3. our results suggest that ITGBL1 is a novel tumor suppressor in non-small cell lung cancer progression. PMID: 26307393
  4. ITGBL1 might be a novel biomarker for ovarian cancer diagnosis. PMID: 27261588
  5. Data indicate the transforming growth factor beta (TGFbeta) signaling pathway as a downstream effector of integrin beta-like 1 (ITGBL1) and the transcription factor Runx2 as an upstream activator of ITGBL1 expression. PMID: 26060017

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Widely expressed in many tissues, but readily detectable only in aorta.
Database Links

HGNC: 6164

OMIM: 604234

KEGG: hsa:9358

STRING: 9606.ENSP00000365351

UniGene: Hs.696554

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*