Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IFI6

Uniprot No.

P09912

Research Area

Cell Biology

Alternative Names

Ifi-6-16; IFI6; IFI6_HUMAN; Interferon alpha-inducible protein 6; Interferon-induced protein 6-16

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

24-130aa

Target Protein Sequence

GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-B2M-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Cloning the gene encoding the Human IFI6 protein (24-130aa) into a plasmid vector leads to the formation of recombinant plasmid. The resulting recombination plasmid is transformed into e.coli cells. e.coli cells containing the recombinant plasmid survive in the presence of a specific antibiotic and are selected to be cultured under conditions conducive to the expression of the gene of interest. A N-terminal 6xHis-B2M tag is linked to the protein. Following expression, the recombinant Human IFI6 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human IFI6 protein, demonstrating a purity exceeding 90%.

Target Background

Function

Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells.

Gene References into Functions

Consequent to its localisation on inner-mitochondrial membrane, mtROS were higher in G1P3-expressing cells (MCF-7G1P3). This study identified that G1P3-induced mtROS have a direct role in migratory structure formation and nuclear gene expression to promote breast cancer cell metastasis. PMID: 29899394
Data suggest that p7 is a critical immune evasion protein that suppresses the antiviral interferon function by counteracting the function of IFI6-16. PMID: 28159892
In insulitic islets from living patients with recent-onset T1D, most of the overexpressed ISGs, including GBP1, TLR3, OAS1, EIF2AK2, HLA-E, IFI6, and STAT1, showed higher expression in the islet core compared with the peri-islet area containing the surrounding immune cells PMID: 27422384
In conclusion, over-expression of IFI6 promotes hepatitis C virus RNA replication and rescues the interferon alpha-mediated anti-hepatitis C virus activity. PMID: 26105982
IFI6 inhibits HCV entry by impairing EGFR mediated CD81/CLDN1 interactions. This may be relevant to other virus entry processes employing EGFR. PMID: 25757571
Here we elucidate G1P3, a survival protein induced by interferons (IFNs), as a target of estrogen signaling and a contributor to poor outcomes in estrogen receptor-positive (ER(+)) breast cancer. PMID: 21996729
PRINS regulates G1P3, a gene with anti-apoptotic effects in keratinocytes. siRNA-mediated inhibition of PRINS gene resulted in altered cell morphology and gene expression alterations. PMID: 20377629
G1P3 protein may have function as a cell survival protein by inhibiting mitochondrial-mediated apoptosis PMID: 15685448
Respiratory syncytial virus upregulated the mRNA expression of chemokines CC and CXC and interfered with type alpha/beta interferon-inducible gene expression by upregulation of MG11 and downregulation of G1P3. PMID: 18838000
IFN-alpha2b induced the expression of G1P3 and antagonized the TRAIL induced apoptosis in myeloma suggesting that either the deregulated or the induced expression of G1P3 could lead to apoptosis resistance in tumor cells. PMID: 17823654

Hide All

Subcellular Location

Mitochondrion inner membrane; Multi-pass membrane protein.

Protein Families

IFI6/IFI27 family

Database Links

HGNC: 4054

OMIM: 147572

KEGG: hsa:2537

UniGene: Hs.523847

Code	CSB-EP011016HU
Abbreviation	Recombinant Human IFI6 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interferon alpha-inducible protein 6 (IFI6)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage