Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (IDH3G)

In Stock
Code CSB-EP010993HU
Abbreviation Recombinant Human IDH3G protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
IDH3G
Uniprot No.
Research Area
Signal Transduction
Alternative Names
H IDHG; IDH gamma; IDH3G; IDH3G_HUMAN; Isocitrate dehydrogenase [NAD] subunit gamma; Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; Isocitrate dehydrogenase 3 (NAD+) gamma; Isocitric dehydrogenase; Isocitric dehydrogenase subunit gamma; mitochondrial; NAD (H) specific isocitrate dehydrogenase gamma subunit; NAD(+) specific ICDH; NAD(+)-specific ICDH subunit gamma; NAD+ specific ICDH; OTTHUMP00000025984; OTTHUMP00000025985; OTTHUMP00000025987; OTTHUMP00000025988; OTTHUMP00000214764
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
40-393aa
Target Protein Sequence
FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (IDH3G) is produced in E. coli and represents the full-length mature protein from amino acids 40 to 393. The protein carries an N-terminal 6xHis-SUMO tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels exceeding 90%, indicating the material should be suitable for research applications.

Isocitrate dehydrogenase [NAD] subunit gamma appears to be a crucial component of the mitochondrial enzyme complex that drives the citric acid cycle—a fundamental metabolic pathway. The protein helps catalyze the oxidative decarboxylation of isocitrate, which contributes to energy production through NADH generation. Given its role in cellular respiration, IDH3G has become a significant focus in metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The human IDH3G is a subunit of the mitochondrial NAD-dependent isocitrate dehydrogenase complex (IDH3), which requires correct folding, assembly with IDH3A and IDH3B subunits, and potential cofactor binding for bioactivity. E. coli expression may facilitate soluble production due to the SUMO tag, but as a prokaryotic system, it lacks mitochondrial chaperones and post-translational modifications needed for optimal folding of eukaryotic metabolic enzymes. The SUMO tag could improve folding but may sterically hinder inter-subunit interactions. While the high purity suggests minimal impurities, correct folding and bioactivity cannot be assumed without validation (e.g., circular dichroism for structure or enzyme assays for complex activity). Therefore, the protein may be misfolded or inactive, and experimental confirmation is essential before functional use.

1. Protein-Protein Interaction Studies

If the recombinant IDH3G is verified to be correctly folded (e.g., through biophysical assays), it could be used to study interactions with IDH3A and IDH3B subunits via pull-down or co-immunoprecipitation. The His tag facilitates immobilization. However, if misfolded, interaction results may be unreliable due to altered binding sites or tag-mediated artifacts. Validation with native complexes from eukaryotic sources is recommended for physiological relevance.

2. Antibody Development and Validation

This recombinant IDH3G can serve as an immunogen for antibody production, as antibodies often recognize linear epitopes even in misfolded proteins. The high purity supports consistent immunization and screening. However, antibodies generated may not bind native IDH3G in mitochondrial complexes due to conformational differences. Specificity should be validated against eukaryotic-expressed IDH3G for applications like Western blot or immunofluorescence.

3. Structural and Biophysical Characterization

The protein is suitable for basic biophysical analyses (e.g., circular dichroism to assess secondary structure, dynamic light scattering to monitor aggregation) to evaluate folding status. However, correct folding is critical for high-resolution structural studies (e.g., X-ray crystallography). A misfolded protein or the SUMO tag may interfere with data interpretation. Tag removal is advised for meaningful structural insights.

4. Biochemical Assays for Complex Assembly

This application requires a correctly folded and functional IDH3G for valid results. If the protein is bioactive (verified through complex reconstitution assays), it could be used to study assembly with IDH3A and IDH3B. However, if misfolded, assembly may fail, leading to false negatives. Pre-validation of enzyme activity or subunit binding is necessary before such experiments.

Final Recommendation & Action Plan

Before using this recombinant IDH3G for any functional application, prioritize experimental validation of its folding and bioactivity. Start with biophysical assays (e.g., circular dichroism to check for expected secondary structure elements, size-exclusion chromatography to assess oligomerization) and functional tests (e.g., in vitro complex reconstitution with IDH3A and IDH3B to measure enzyme activity). If activity is confirmed, proceed with interaction or structural studies; otherwise, limit use to non-functional applications like antibody production, but always validate outcomes with native IDH3G. For reliable results, consider expressing IDH3G in a eukaryotic system (e.g., yeast or mammalian cells) to ensure proper folding and complex assembly. Avoid functional assays without prior activity confirmation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
Gene References into Functions
  1. Aspartate-190 is a determinant of IDH gamma subunit affinity for the manganese (MnII) ion, as well as for nicotinamide-adenine dinucleotide (NAD), but is not directly required for the catalytic reaction. PMID: 17432878
Subcellular Location
Mitochondrion.
Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Database Links

HGNC: 5386

OMIM: 300089

KEGG: hsa:3421

STRING: 9606.ENSP00000217901

UniGene: Hs.410197

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*