Recombinant Human Kallikrein-12 (KLK12)

In Stock
Code CSB-EP892137HU
Abbreviation Recombinant Human KLK12 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KLK12
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
18-248aa
Target Protein Sequence
ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. results demonstrate the discriminative value of KLK12sv1/2 and KLK12sv3 between benign and malignant breast tumors as well as their potential favorable prognostic significance in breast adenocarcinoma. PMID: 29807016
  2. KLK12 gene silencing reduces gastric cancer cell proliferation and migration. PMID: 27706634
  3. Data indicate that the KLK12 SNP rs3865443 was not associated with tumor aggressiveness but showed marginal association with prostate cancer risk for the rare homozygote. PMID: 21741862
  4. KLK12 gene is markedly overexpressed in gastric cancer PMID: 23236234
  5. the proangiogenic activity of KLK12 in lung endothelial cells was not related to a kinin release PMID: 23152405
  6. Results suggest that kallikrein-related peptidase 12 (KLK12) splice variant KLK12sv3 can be regarded as a marker of good prognosis in breast cancer. PMID: 22351561
  7. KLK12 may indirectly regulate the bioavailability and activity of several growth factors through processing of their CCN binding partners PMID: 21628462
  8. 4 types of polymorphisms were found in Japanese gastric cancer: 1 at an intron 4 splice-donor site (c.457+2T>C), 2 in exon 6 (c.618_619delTG:p.Cys206fsX72 & c.735G>A:p.Met245Ile), & 1 in intron 3. c.457+2C/C has no hK12 serine protease expression. PMID: 15300858
  9. KLK12 has trypsin-like activity, cleaving peptide bonds after both arginine & lysine. It quickly loses its activity due to autodegradation, its activity can also be rapidly inhibited by zinc ions & by alpha2-antiplasmin through covalent complex formation. PMID: 17391064

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Database Links

HGNC: 6360

OMIM: 605539

KEGG: hsa:43849

STRING: 9606.ENSP00000250351

UniGene: Hs.411572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*