Recombinant Human Kallikrein-12 (KLK12)

Code CSB-YP892137HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP892137HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP892137HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP892137HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
KLK12
Uniprot No.
Alternative Names
KLK12; KLKL5; UNQ669/PRO1303Kallikrein-12; EC 3.4.21.-; Kallikrein-like protein 5; KLK-L5
Species
Homo sapiens (Human)
Expression Region
18-248
Target Protein Sequence
ATP KIFNGTECGR NSQPWQVGLF EGTSLRCGGV LIDHRWVLTA AHCSGSRYWV RLGEHSLSQL DWTEQIRHSG FSVTHPGYLG ASTSHEHDLR LLRLRLPVRV TSSVQPLPLP NDCATAGTEC HVSGWGITNH PRNPFPDLLQ CLNLSIVSHA TCHGVYPGRI TSNMVCAGGV PGQDACQGDS GGPLVCGGVL QGLVSWGSVG PCGQDGIPGV YTYICKYVDW IRMIMRNN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding your protein CSB-EP892137HU, could you please provide some informatins for all available sizes?
Additionally, do you know if any customers regularly order this protein, or if any of the expression hosts are expected to produce to have activity?

A:
Thanks for your inquiry.
Expression Region:18-248aa; Mature full length protein.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN


Sorry, we haven't expressed this protein up to now, and haven't validated the activity, so we can't guarantee that it's 100% active.
However, what we provide is the mature full length protein, and it's purified under very mild condition, in theory, it has great potential to be active.We preferentially recommend the protein expressed by the eukaryotic expression system.
In addition,an attached literature introduces that this protein expressed by the mammalian cell expression system is active.

Target Background

Gene References into Functions
  1. results demonstrate the discriminative value of KLK12sv1/2 and KLK12sv3 between benign and malignant breast tumors as well as their potential favorable prognostic significance in breast adenocarcinoma. PMID: 29807016
  2. KLK12 gene silencing reduces gastric cancer cell proliferation and migration. PMID: 27706634
  3. Data indicate that the KLK12 SNP rs3865443 was not associated with tumor aggressiveness but showed marginal association with prostate cancer risk for the rare homozygote. PMID: 21741862
  4. KLK12 gene is markedly overexpressed in gastric cancer PMID: 23236234
  5. the proangiogenic activity of KLK12 in lung endothelial cells was not related to a kinin release PMID: 23152405
  6. Results suggest that kallikrein-related peptidase 12 (KLK12) splice variant KLK12sv3 can be regarded as a marker of good prognosis in breast cancer. PMID: 22351561
  7. KLK12 may indirectly regulate the bioavailability and activity of several growth factors through processing of their CCN binding partners PMID: 21628462
  8. 4 types of polymorphisms were found in Japanese gastric cancer: 1 at an intron 4 splice-donor site (c.457+2T>C), 2 in exon 6 (c.618_619delTG:p.Cys206fsX72 & c.735G>A:p.Met245Ile), & 1 in intron 3. c.457+2C/C has no hK12 serine protease expression. PMID: 15300858
  9. KLK12 has trypsin-like activity, cleaving peptide bonds after both arginine & lysine. It quickly loses its activity due to autodegradation, its activity can also be rapidly inhibited by zinc ions & by alpha2-antiplasmin through covalent complex formation. PMID: 17391064

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Database Links

HGNC: 6360

OMIM: 605539

KEGG: hsa:43849

STRING: 9606.ENSP00000250351

UniGene: Hs.411572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1