Recombinant Human Kallikrein-1 (KLK1)

Promotion
Code CSB-EP012446HU
Abbreviation Recombinant Human KLK1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Glandular kallikrein 1; hK 1; hK1; Kallikrein serine protease 1; Kallikrein-1; Kidney/pancreas/salivary gland kallikrein; Klk 6; KLK1; KLK1_HUMAN; Klk6; KLKR; Tissue kallikrein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-262aa
Target Protein Sequence
IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Gene References into Functions
  1. Our findings suggest that the A2233C polymorphism of KLK1 may be a marker of evaluation of hypertensive subjects' responses to angiotensin I converting enzyme inhibitors benazepril. PMID: 28621557
  2. Recognition of anti-tumor necrosis factor-alpha (TNF-alpha) or Kallikrein Inhibitor may lead to therapeutics to enhance existing treatments for patients who do not respond to anti-vascular endothelial growth factor (VEGF) therapies. PMID: 27618014
  3. increasing the serum levels of AngII increased the risk of acute myocardial infarction (AMI); the risk of AMI increased when the serum levels of AngII and KLK1 simultaneously increased; individuals with the combined genotypes of ACE DD and KLK1 GG showed increased risk of AMI compared with those with the combined genotypes of ACE II and KLK1 AA PMID: 27329205
  4. The rs5516 G allele of KLK1 was significantly associated with aortic aneurysm PMID: 27858843
  5. KLK1 rs5516 SNP is not related to the incidence of Alzheimer's disease in a Hunan Han Chinese population. PMID: 26884824
  6. TK promoted cell survival and beta-catenin degradation in serum-starved SH-SY5Y cells via increasing autophagy. PMID: 26677174
  7. Our findings suggest that higher levels of TK in plasma are associated with the presence of CAD and are a predictor of mild coronary arteriosclerosis. PMID: 24626253
  8. The kallikrein system in retinal damage/protection PMID: 25448306
  9. Preclinical characterization of recombinant human tissue kallikrein-1 as a novel treatment for type 2 diabetes mellitus. PMID: 25100328
  10. Up-regulation of KLK1 in tubular epithelial cells may mediate pro-inflammatory pathway and PAR activation during diabetic nephropathy. PMID: 24586431
  11. These data do not support a role for the Tissue kallikrein-kinin system, protective or deleterious, in the development of insulin resistance and diabetes. PMID: 24599937
  12. Tissue kallikrein facilitated the activation of EGFR, ERK1/2 and p38 cascade. Not p38 but ERK1/2 phosphorylation was severely compromised in cells depleted of EGFR. Impairment of signaling of ERK1/2 seemed not to be restricted to EGFR phosphorylation. PMID: 24530396
  13. allele H is a common polymorphism in Japanese and may contribute to decreased reabsorptions of calcium and sodium in the kidney PMID: 24005896
  14. Data suggest factor XII binding/autoactivation are increased on surface of hantavirus-infected vascular endothelium; thus, activation of kallikrein-kinin system during hantavirus infection could have profound implications on capillary permeability. PMID: 23874198
  15. Tissue kallikrein-modified mesenchymal stem cells provide enhanced protection against ischemic cardiac injury after myocardial infarction. PMID: 23697984
  16. KLK1 promoter polymorphisms are associated with development of AKI and adverse outcomes. Further studies are needed to validate these findings. PMID: 23635481
  17. Polymorphism of the KLK1 A1789G gene is associated with coronary artery stenosis. PMID: 23765970
  18. Unexpectedly, elevated KLK1 expression and excretion is found in patients with established or incipient acute kidney injury. PMID: 21679467
  19. Suggest that a genetic polymorphism in KLK1 may contribute to the risk of developing later stage abdominal aortic aneurysm. PMID: 21571276
  20. Neither rs5515 nor rs3212855 SNP is associated with cerebral hemorrhage. PMID: 21200088
  21. Data suggest that lower plasma tissue kallikrein levels are independently associated with first-ever stroke and are an independent predictor of recurrence after an initial stroke. PMID: 21823154
  22. rs5516 in the KLK1 gene may be involved in the development of essential hypertension. PMID: 20613781
  23. lung epithelial cells support the assembly and activation of the plasma kallikrein-kinin system by a mechanism dependent on HSP90, and could contribute to KKS-mediated inflammation in lung disease. PMID: 20536386
  24. Increased expression of hK1 by astrocytes co-localized with GFAP was found, contrasting with kinin B1 and B2 receptors, which were co-localized with NeuN in the sclerotic hippocampus PMID: 21211543
  25. Tissue kallikrein is essential for invasive capacity of circulating proangiogenic cells. PMID: 21164105
  26. The results indicate differential signaling pathways mediated by TK in promoting prostate cancer cell migration and invasion via PAR(1) activation, and proliferation via kinin B2 receptor stimulation. PMID: 20482314
  27. Results suggested that the rs5517 polymorphism was associated with cerebral hemorrhage, while the rs5516 polymorphism was not in Changsha Han Chinese. PMID: 20533273
  28. KLK1 gene polymorphisms are not associated with lupus nephritis in a Chinese Han population. PMID: 20516044
  29. Tissue kallikrein levels are increased in type 2 diabetes, and findings do not support a role for the kallikrein-kinin system in mediating the effects of statin therapy on endothelial function. PMID: 20225398
  30. elevated plasma levels in patients with hereditary angioedema PMID: 20143645
  31. we propose a model to illustrate how the two enhancers may work to regulate the transcription of PSA and hK2. PMID: 9857240
  32. Tissue kallikrein KLK1 is expressed de novo in endothelial cells and mediates relaxation of human umbilical veins. PMID: 11727832
  33. Association of the tissue kallikrein gene promoter with ESRD and hypertension. PMID: 11849458
  34. Loss-of-function polymorphism of the human kallikrein gene with reduced urinary kallikrein activity. PMID: 11912256
  35. Kinetic peculiarities of human tissue kallikrein PMID: 11913965
  36. endothelial cells synthesize and release an active form of tissue kallikrein - kinin generation on the surface may play an important role in maintenance of circulation homeostasis PMID: 12581867
  37. Diminution of kallikrein biosynthesis in African Americans seems to involve mechanisms at or distal to the aldosterone receptor, and perhaps at the level of the kallikrein gene itself. PMID: 12670744
  38. essentially unsusceptible to processing by human urinary kallikrein (tissue-type) PMID: 12887060
  39. that in the airways, monocytes, neutrophils, and alveolar macrophages may contribute to increased TK activity PMID: 14660481
  40. Sustained hyaluronan depolymerization is expected to cause tissue kallikrein activation, EGF release, and EGFR signaling. PMID: 14988406
  41. The K allele of KLK1 promoter and TT genotype of TGF-beta1 may be a genetic KLK1 -130 GN and -128 G-C, and the susceptibility factor contributing to progressive renal deterioration in Taiwanese primary vesicoureteric reflux children. PMID: 15086490
  42. Transduced human tissue kallikrein activated murine Akt-B through Ser-473 phosphorylation providing new information on the pathway involved in hTK-induced neoangiogenesis. PMID: 15364809
  43. transgenic rats expressing hKLK1 have an impaired renal response to acute volume expansion PMID: 15544850
  44. kallikrein/kinin protects against cardiomyocyte apoptosis in vivo and in vitro via Akt-Bad.14-3-3 and Akt-GSK-3beta-caspase-3 signaling pathways PMID: 15611141
  45. analysis of peptide inhibitor/substrate binding to human apo kallikrein 1 PMID: 15651049
  46. Induction of KLK1 in carotid arteriosclerosis does not lead to kallikrein-kinins pathway activation. PMID: 15662224
  47. Data describe the vascular, hormonal, and renal phenotypes of carriers of the loss-of-function polymorphism of the human tissue kallikrein gene. PMID: 15765151
  48. Gene delivery protects against rat diabetic cardiomyopathy by improving cardiac function and promoting glucose utilization and lipid metabo PMID: 15855348
  49. There are polymorphisms in regulatory region of human tissue kallikrein gene in Chinese Han people. Differences in both allele and genotype frequencies show association of hypertension with polymorphisms. PMID: 15905889
  50. the the kallikrein-kinin system has roles in intramyocardial inflammation, endothelial dysfunction and oxidative stress in diabetic cardiomyopathy PMID: 16129698

Show More

Hide All

Protein Families
Peptidase S1 family, Kallikrein subfamily
Tissue Specificity
Isoform 2 is expressed in pancreas, salivary glands, kidney, colon, prostate gland, testis, spleen and the colon adenocarcinoma cell line T84.
Database Links

HGNC: 6357

OMIM: 147910

KEGG: hsa:3816

STRING: 9606.ENSP00000301420

UniGene: Hs.123107

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*