Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

KIR2DL5A

Uniprot No.

Q8N109

Research Area

Others

Alternative Names

(CD antigen CD158f1)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-238aa

Target Protein Sequence

HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

30.7 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process of expressing the recombinant Human KIR2DL5A protein includes transfecting e.coli cells with a DNA expression vector carrying the gene for the desired protein (22-238aa). Subsequently, the cells are cultured to induce the expression of the intended protein. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. The recombinant Human KIR2DL5A protein is then collected and purified from the cell lysate through affinity purification, exhibiting a purity exceeding 85%, as verified by SDS-PAGE.

Target Background

Function

Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.

Gene References into Functions

KIR 2DL5 was associated with decreased CMV infection and better platelets engraftment after hematopoietic stem cell transplantation from matched sibling PMID: 28993188
these findings establish KIR2DL5 as a new Schwann cell growth regulator relevant to sp-DNF pathogenesis, which links sporadic and NF1-associated DNFs through RAS pathway hyperactivation. PMID: 28548933
Loss of KIR2DL5A gene is associated with breast cancer. PMID: 27631728
KIR2DL5 gene polymorphism is associated with HIV-1 infection. PMID: 26888639
We observed statistically lower carrier frequencies of cB03|tA01 gene-content haplotype, of cB03 haplotype motif, of the KIR2DL5 + 2DS3/2DS5 gene pair and of KIR2DL5 amongst CMV-positive pregnant women in comparison with those CMV negative PMID: 27277336
Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load. PMID: 25253288
The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases. PMID: 24929143
A significant upregulation of KIR2DL5A occurs in Alzheimer's disease fast progessors compared to slow progressors. PMID: 23234877
indicate that killer-cell immunoglobulin-like receptors (KIRs)activator (KIR3DS1 and KIR2DS5) and inhibitory (KIR2DL5) genes are associated with severe pandemic influenza A (H1N1) 2009 infections. PMID: 22652695
KIR2DL5 is a candidate gene involved in immunomodulation associated with non-response to antiviral therapy. PMID: 20456039
Human KIR2DL5 has at least 4 gene variants, whose exons differ by 2 to 8 nucleotides. These structurally similar variants are encoded by alleles of 2 different loci, KIR2DL5A and KIR2DL5B, which map to different regions of the KIR-gene cluster. PMID: 12185535
The frequencies of KIR2DS1 and KIR2DL5 were significantly increased in psoriasis vulgaris cases compared with controls PMID: 15140215
the cytoplasmic domains of type II KIRs (2DL4 and 2DL5) exhibit distinct inhibitory capacities when compared with type I KIRs (3DL1), due to alterations in the canonical immunoreceptor tyrosine-based inhibitory motifs PMID: 15187115
We report here the identification and characterization of the receptor encoded by KIR2DL5 using a newly generated specific mAb that recognizes its most commonly expressed allele, KIR2DL5A*001. PMID: 17371997
Sequencing a KIR2DL5 variant using a first-generation high-throughput method proves it is a newly discovered allele, one that appears associated with Hispanic and Native American populations. PMID: 17464504
we investigate the relationship between the sequence diversity of KIR2DL5, including three novel alleles, and its variable transcription. PMID: 17557377
Carriage of inhibitory 2dl5 was increased in patients with herpes virus RDs. PMID: 17592337
Promoter variants of KIR2DL5 add to diversity and may impact gene expression. PMID: 18461314
Alleles commonly found in a Northern Irish population of 354 individuals were KIR2DL5A*001, KIR2DL5A*005, and KIR2DL5B*002. PMID: 18498296
The nature of KIR2DL5 gene polymorphism into four ethnic groups using direct DNA sequencing method was elucidated. PMID: 18509341

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Immunoglobulin superfamily

Database Links

HGNC: 16345

OMIM: 605305

KEGG: hsa:57292

UniGene: Hs.740906

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP854013HU
Abbreviation	Recombinant Human KIR2DL5A protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Killer cell immunoglobulin-like receptor 2DL5A (KIR2DL5A), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage