Recombinant Human Killer cell immunoglobulin-like receptor 2DL5A (KIR2DL5A), partial

In Stock
Code CSB-EP854013HU
Abbreviation Recombinant Human KIR2DL5A protein, partial
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(CD antigen CD158f1)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-238aa
Target Protein Sequence
HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of expressing the recombinant Human KIR2DL5A protein includes transfecting e.coli cells with a DNA expression vector carrying the gene for the desired protein (22-238aa). Subsequently, the cells are cultured to induce the expression of the intended protein. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. The recombinant Human KIR2DL5A protein is then collected and purified from the cell lysate through affinity purification, exhibiting a purity exceeding 85%, as verified by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Gene References into Functions
  1. KIR 2DL5 was associated with decreased CMV infection and better platelets engraftment after hematopoietic stem cell transplantation from matched sibling PMID: 28993188
  2. these findings establish KIR2DL5 as a new Schwann cell growth regulator relevant to sp-DNF pathogenesis, which links sporadic and NF1-associated DNFs through RAS pathway hyperactivation. PMID: 28548933
  3. Loss of KIR2DL5A gene is associated with breast cancer. PMID: 27631728
  4. KIR2DL5 gene polymorphism is associated with HIV-1 infection. PMID: 26888639
  5. We observed statistically lower carrier frequencies of cB03|tA01 gene-content haplotype, of cB03 haplotype motif, of the KIR2DL5 + 2DS3/2DS5 gene pair and of KIR2DL5 amongst CMV-positive pregnant women in comparison with those CMV negative PMID: 27277336
  6. Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load. PMID: 25253288
  7. The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases. PMID: 24929143
  8. A significant upregulation of KIR2DL5A occurs in Alzheimer's disease fast progessors compared to slow progressors. PMID: 23234877
  9. indicate that killer-cell immunoglobulin-like receptors (KIRs)activator (KIR3DS1 and KIR2DS5) and inhibitory (KIR2DL5) genes are associated with severe pandemic influenza A (H1N1) 2009 infections. PMID: 22652695
  10. KIR2DL5 is a candidate gene involved in immunomodulation associated with non-response to antiviral therapy. PMID: 20456039
  11. Human KIR2DL5 has at least 4 gene variants, whose exons differ by 2 to 8 nucleotides. These structurally similar variants are encoded by alleles of 2 different loci, KIR2DL5A and KIR2DL5B, which map to different regions of the KIR-gene cluster. PMID: 12185535
  12. The frequencies of KIR2DS1 and KIR2DL5 were significantly increased in psoriasis vulgaris cases compared with controls PMID: 15140215
  13. the cytoplasmic domains of type II KIRs (2DL4 and 2DL5) exhibit distinct inhibitory capacities when compared with type I KIRs (3DL1), due to alterations in the canonical immunoreceptor tyrosine-based inhibitory motifs PMID: 15187115
  14. We report here the identification and characterization of the receptor encoded by KIR2DL5 using a newly generated specific mAb that recognizes its most commonly expressed allele, KIR2DL5A*001. PMID: 17371997
  15. Sequencing a KIR2DL5 variant using a first-generation high-throughput method proves it is a newly discovered allele, one that appears associated with Hispanic and Native American populations. PMID: 17464504
  16. we investigate the relationship between the sequence diversity of KIR2DL5, including three novel alleles, and its variable transcription. PMID: 17557377
  17. Carriage of inhibitory 2dl5 was increased in patients with herpes virus RDs. PMID: 17592337
  18. Promoter variants of KIR2DL5 add to diversity and may impact gene expression. PMID: 18461314
  19. Alleles commonly found in a Northern Irish population of 354 individuals were KIR2DL5A*001, KIR2DL5A*005, and KIR2DL5B*002. PMID: 18498296
  20. The nature of KIR2DL5 gene polymorphism into four ethnic groups using direct DNA sequencing method was elucidated. PMID: 18509341

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Database Links

HGNC: 16345

OMIM: 605305

KEGG: hsa:57292

UniGene: Hs.740906

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*