Recombinant Human Killer cell immunoglobulin-like receptor 2DS3(KIR2DS3),partial

In Stock
Code CSB-EP613530HUb1
Product Type Recombinant Protein
Size US$2062
Uniprot No. Q14952
Lead Time 3-7 business days
Relevance Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Research Area Others
Source E.coli
Gene Names KIR2DS3
Protein Names MHC class I NK cell receptor Natural killer-associated transcript 7 Short name: NKAT-7 NKAT7
Expression Region 22-245aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 31.7 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Database Links

HGNC: 6335

OMIM: 604954

KEGG: hsa:3808

UniGene: Hs.744266

Pathway Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR2DS3 Antibodies

KIR2DS3 Antibodies for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.