Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

In Stock
Code CSB-EP613530HUb1
Abbreviation Recombinant Human KIR2DS3 protein, partial
MSDS
Size US$256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
KIR2DS3; NKAT7Killer cell immunoglobulin-like receptor 2DS3; MHC class I NK cell receptor; Natural killer-associated transcript 7; NKAT-7
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-245aa
Target Protein Sequence
HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.7 kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Gene References into Functions
  1. activating KIR2DS3 was associated with rapid leukocyte engraftment after hematopoietic stem cell transplantation from matched sibling PMID: 28993188
  2. Genotypes missing these two inhibitory KIR-HLA combinations in addition to missing activating KIRs 2DS2 and 2DS3 were more common in Vogt-Koyanagi-Harada disease (OR = 1.90, P = 0.002). PMID: 27490240
  3. Loss of KIR2DS3 gene is associated with breast cancer. PMID: 27631728
  4. genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians PMID: 26472014
  5. The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases. PMID: 24929143
  6. the presence of host genetic risk factors, IL28B-T and KIR2DS3 alleles, resulted in increased odds of treatment failure in these rapid virological response negative patients. PMID: 23826153
  7. KIR2DS3 and HLA-class I alleles (-Cw*14 and -Cw*17) may play a role in the pathogenesis of the Vogt-Koyanagi-Harada disease. PMID: 22219647
  8. The Natural Killer cell gene KIR2DS3 was significantly increased in patients with chronic hepatitis C virus infection. PMID: 21402922
  9. KIR2DS3 is associated with protection against acute myeloid leukemia. PMID: 20371915
  10. Positive linkage disequilibrium was seen between KRI2DS2 and KIR2DS3. Positive linkage disequilibrium was seen between KIR3DS1 and KIR2DS3. PMID: 12559621
  11. KIR2DS3 is a protective factor for chronic graft-versus-host disease. PMID: 17462498
  12. This focuses on the inheritance of KIR2DS3*001 and *002 to clarify their genetic relationship, and will investigate the diversity of haplotypes containing a KIR2DS3 gene. PMID: 18480828
  13. Genomic and mRNA sequences support the KIR2DS3*002 gene being a hybrid of KIR2DS3*00103 and KIR2DS5. PMID: 18764809
  14. Dramatically reduced surface expression of NK cell receptor KIR2DS3 is attributed to multiple residues throughout the molecule. PMID: 19005473
  15. KIR2DS3 incompatibilities increased risk of chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation PMID: 19500138

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Database Links

HGNC: 6335

OMIM: 604954

KEGG: hsa:3808

UniGene: Hs.744266

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*